StarFunc result for job id O75907

User Input

>input (488 residues)
MGDRGSSRRRRTGSRPSSHGGGGPAAAEEEVRDAAAGPDVGAAGDAPAPAPNKDGDAGVG
SGHWELRCHRLQDSLFSSDSGFSNYRGILNWCVVMLILSNARLFLENLIKYGILVDPIQV
VSLFLKDPYSWPAPCLVIAANVFAVAAFQVEKRLAVGALTEQAGLLLHVANLATILCFPA
AVVLLVESITPVGSLLALMAHTILFLKLFSYRDVNSWCRRARAKAASAGKKASSAAAPHT
VSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIRKRFLLRRILEMLFFTQLQVGLIQQWM
VPTIQNSMKPFKDMDYSRIIERLLKLAVPNHLIWLIFFYWLFHSCLNAVAELMQFGDREF
YRDWWNSESVTYFWQNWNIPVHKWCIRHFYKPMLRRGSSKWMARTGVFLASAFFHEYLVS
VPLRMFRLWAFTGMMAQIPLAWFVGRFFQGNYGNAAVWLSLIIGQPIAVLMYVHDYYVLN
YEAPAAEA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75907	1.000	1.000	4.269E-64	488	1.000	1.000	O75907.pdb.gz	DGAT1_HUMAN Diacylglycerol O-acyltransferase 1 OS=Homo sapiens OX=9606 GN=DGAT1 PE=1 SV=2
2	AFDB:Q9ERM3	0.720	0.706	5.991E-51	498	0.861	0.843	Q9ERM3.pdb.gz	DGAT1_RAT Diacylglycerol O-acyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Dgat1 PE=2 SV=1
3	AFDB:F1MIW3	0.705	0.704	5.623E-50	489	0.889	0.888	F1MIW3.pdb.gz	F1MIW3_BOVIN O-acyltransferase OS=Bos taurus OX=9913 GN=DGAT1 PE=3 SV=3
4	AFDB:F1Q9Z3	0.723	0.698	1.736E-43	507	0.635	0.611	F1Q9Z3.pdb.gz
5	PDB:6vz1A	0.685	0.806	1.751E-43	411	0.842	1.000	6vz1A.pdb.gz	Structure and catalytic mechanism of a human triacylglycerol-synthesis enzyme.
6	AFDB:Q8ST50	0.755	0.655	2.486E-31	565	0.393	0.340	Q8ST50.pdb.gz	Q8ST50_DROME O-acyltransferase OS=Drosophila melanogaster OX=7227 GN=mdy PE=2 SV=1
7	AFDB:Q55BH9	0.768	0.612	2.056E-28	617	0.330	0.261	Q55BH9.pdb.gz	DGAT1_DICDI Diacylglycerol O-acyltransferase 1 OS=Dictyostelium discoideum OX=44689 GN=dgat1 PE=3 SV=2
8	AFDB:I1MSF2	0.780	0.756	1.151E-27	504	0.365	0.353	I1MSF2.pdb.gz	DAT1B_SOYBN Diacylglycerol O-acyltransferase 1B OS=Glycine max OX=3847 GN=DGAT1B PE=1 SV=1
9	AFDB:Q0QJI1	0.772	0.719	1.367E-27	526	0.357	0.331	Q0QJI1.pdb.gz	Q0QJI1_VERFO O-acyltransferase OS=Vernicia fordii OX=73154 GN=DGAT1 PE=2 SV=1
10	AFDB:Q9SLD2	0.776	0.730	3.235E-27	520	0.361	0.338	Q9SLD2.pdb.gz	DGAT1_ARATH Diacylglycerol O-acyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=DGAT1 PE=1 SV=2
11	AFDB:A0A161IUT7	0.744	0.676	1.105E-25	539	0.352	0.319	A0A161IUT7.pdb.gz	DGAT1_CORAE Diacylglycerol O-acyltransferase 1 OS=Corylus americana OX=78632 GN=DGAT1 PE=1 SV=1
12	PDB:7n6qA	0.625	0.798	7.192E-15	375	0.199	0.259	7n6qA.pdb.gz	Structure of PPPA bound human ACAT2
13	PDB:6vumA	0.619	0.729	9.336E-13	409	0.195	0.232	6vumA.pdb.gz	Structure of nevanimibe-bound tetrameric human ACAT1.
14	PDB:7mhyA	0.386	0.384	1.051E-3	491	0.115	0.114	7mhyA.pdb.gz	Substrate and product complexes reveal mechanisms of Hedgehog acylation by HHAT.
15	PDB:7uraA	0.284	0.310	5.400E-3	432	0.131	0.148	7uraA.pdb.gz	Mechanisms and inhibition of Porcupine-mediated Wnt acylation.
16	PDB:7p5jA	0.095	0.108	4.557E-1	399	0.111	0.135	7p5jA.pdb.gz
17	PDB:6zfzA	0.088	0.094	7.976E-1	446	0.105	0.114	6zfzA.pdb.gz	From structure to clinic: Design of a muscarinic M1 receptor agonist with potential to treatment of Alzheimer's disease.
18	PDB:4xesA	0.119	0.122	8.693E-1	471	0.102	0.106	4xesA.pdb.gz	Structural prerequisites for G-protein activation by the neurotensin receptor.
19	PDB:7p5cA	0.097	0.116	9.892E-1	392	0.076	0.094	7p5cA.pdb.gz
20	PDB:6a2jA	0.138	0.194	1.175	309	0.090	0.142	6a2jA.pdb.gz	Crystal structure of heme A synthase fromBacillus subtilis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1MIW3	0.0	800	489	0.846	0.845	F1MIW3_BOVIN O-acyltransferase OS=Bos taurus OX=9913 GN=DGAT1 PE=3 SV=3
2	O75907	0.0	1005	488	1.000	1.000	DGAT1_HUMAN Diacylglycerol O-acyltransferase 1 OS=Homo sapiens OX=9606 GN=DGAT1 PE=1 SV=2
3	Q6DHG2	0.0	612	507	0.611	0.588	Q6DHG2_DANRE O-acyltransferase OS=Danio rerio OX=7955 GN=zgc:92327 PE=2 SV=1
4	Q8MK44	0.0	804	489	0.846	0.845	DGAT1_BOVIN Diacylglycerol O-acyltransferase 1 OS=Bos taurus OX=9913 GN=DGAT1 PE=1 SV=2
5	Q9ERM3	0.0	831	498	0.842	0.825	DGAT1_RAT Diacylglycerol O-acyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Dgat1 PE=2 SV=1
6	Q9Z2A7	0.0	837	498	0.842	0.825	DGAT1_MOUSE Diacylglycerol O-acyltransferase 1 OS=Mus musculus OX=10090 GN=Dgat1 PE=1 SV=1
7	Q960U8	5.17e-128	385	565	0.395	0.342	Q960U8_DROME O-acyltransferase OS=Drosophila melanogaster OX=7227 GN=mdy PE=2 SV=1
8	Q8ST50	1.40e-127	384	565	0.395	0.342	Q8ST50_DROME O-acyltransferase OS=Drosophila melanogaster OX=7227 GN=mdy PE=2 SV=1
9	Q5GKZ7	1.95e-96	302	498	0.381	0.373	DAT1A_SOYBN Diacylglycerol O-acyltransferase 1A OS=Glycine max OX=3847 GN=DGAT1A PE=1 SV=1
10	I1MSF2	6.70e-96	300	504	0.385	0.373	DAT1B_SOYBN Diacylglycerol O-acyltransferase 1B OS=Glycine max OX=3847 GN=DGAT1B PE=1 SV=1
11	Q0QJI1	7.90e-96	301	526	0.383	0.356	Q0QJI1_VERFO O-acyltransferase OS=Vernicia fordii OX=73154 GN=DGAT1 PE=2 SV=1
12	A0A161IUT7	3.26e-95	300	539	0.373	0.338	DGAT1_CORAE Diacylglycerol O-acyltransferase 1 OS=Corylus americana OX=78632 GN=DGAT1 PE=1 SV=1
13	Q55BH9	3.02e-93	297	617	0.330	0.261	DGAT1_DICDI Diacylglycerol O-acyltransferase 1 OS=Dictyostelium discoideum OX=44689 GN=dgat1 PE=3 SV=2
14	Q9M4V2	3.83e-93	293	501	0.381	0.371	Q9M4V2_BRANA O-acyltransferase OS=Brassica napus OX=3708 GN=DGAT1.a PE=2 SV=1
15	Q9SLD2	3.14e-88	281	520	0.350	0.329	DGAT1_ARATH Diacylglycerol O-acyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=DGAT1 PE=1 SV=2
16	O97295	2.89e-45	169	653	0.203	0.152	O97295_PLAF7 O-acyltransferase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0322300 PE=3 SV=1
17	P53629	5.23e-30	125	642	0.160	0.121	ARE2_YEAST Sterol O-acyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARE2 PE=1 SV=1
18	O75908	1.08e-29	124	522	0.217	0.203	SOAT2_HUMAN Sterol O-acyltransferase 2 OS=Homo sapiens OX=9606 GN=SOAT2 PE=1 SV=1
19	Q61263	5.93e-28	119	540	0.256	0.231	SOAT1_MOUSE Sterol O-acyltransferase 1 OS=Mus musculus OX=10090 GN=Soat1 PE=1 SV=2
20	O88908	7.07e-27	115	525	0.182	0.170	SOAT2_MOUSE Sterol O-acyltransferase 2 OS=Mus musculus OX=10090 GN=Soat2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03062 MBOAT	5.8e-66	234.8	MBOAT, membrane-bound O-acyltransferase family
2	PF13813 MBOAT_2	6.8e+02	11.9	Membrane bound O-acyl transferase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000482264

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000406674	0.996	2-acylglycerol O-acyltransferase 1
2	9606.ENSP00000198801	0.992	2-acylglycerol O-acyltransferase 2
3	9606.ENSP00000228027	0.992	Diacylglycerol O-acyltransferase 2
4	9606.ENSP00000223114	0.984	2-acylglycerol O-acyltransferase 3
5	9606.ENSP00000397908	0.941	Phosphatidate phosphatase LPIN1
6	9606.ENSP00000264775	0.938	Phospholipid phosphatase 1
7	9606.ENSP00000337701	0.936	Patatin-like phospholipase domain-containing protein 2
8	9606.ENSP00000262340	0.933	Retinoid isomerohydrolase
9	9606.ENSP00000307607	0.932	Epidermal retinol dehydrogenase 2
10	9606.ENSP00000381302	0.931	Phospholipid phosphatase 4
11	9606.ENSP00000392553	0.931	Phospholipid phosphatase 5
12	9606.ENSP00000421172	0.928	Acyl-CoA wax alcohol acyltransferase 2
13	9606.ENSP00000240285	0.921	Retinol dehydrogenase 10
14	9606.ENSP00000326219	0.921	Dehydrogenase/reductase SDR family member 4
15	9606.ENSP00000329697	0.920	Phospholipid phosphatase 2
16	9606.ENSP00000224356	0.918	Cytochrome P450 26A1
17	9606.ENSP00000389241	0.916	Dehydrogenase/reductase SDR family member 9
18	9606.ENSP00000295802	0.915	All-trans-retinol 13,14-reductase
19	9606.ENSP00000257895	0.913	11-cis retinol dehydrogenase
20	9606.ENSP00000480439	0.913	Short-chain dehydrogenase/reductase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004144	1.000	diacylglycerol O-acyltransferase activity
GO:0005488	0.995	binding
GO:0005515	0.956	protein binding
GO:0042802	0.403	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044255	0.995	cellular lipid metabolic process
GO:0008610	0.989	lipid biosynthetic process
GO:0046486	0.987	glycerolipid metabolic process
GO:0006638	0.986	neutral lipid metabolic process
GO:0006639	0.984	acylglycerol metabolic process
GO:0006641	0.947	triglyceride metabolic process
GO:0045017	0.937	glycerolipid biosynthetic process
GO:0019432	0.918	triglyceride biosynthetic process
GO:0065007	0.843	biological regulation
GO:0050789	0.691	regulation of biological process
GO:0032501	0.387	multicellular organismal process
GO:0044281	0.368	small molecule metabolic process
GO:0006796	0.315	phosphate-containing compound metabolic process
GO:0050794	0.309	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.997	endomembrane system
GO:0005886	0.984	plasma membrane
GO:0005737	0.979	cytoplasm
GO:0031090	0.921	organelle membrane
GO:0005789	0.914	endoplasmic reticulum membrane
GO:0031982	0.799	vesicle
GO:0097708	0.360	intracellular vesicle
GO:0031410	0.318	cytoplasmic vesicle
GO:0098588	0.300	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10868	1.000	a 1,2-diacyl-sn-glycerol + an acyl-CoA = a triacyl-sn-glycerol + CoA
EC:2.3.1.20	1.000	diacylglycerol O-acyltransferase.

[back to server]