StarFunc result for job id O75909

User Input

>input (580 residues)
MKENKENSSPSVTSANLDHTKPCWYWDKKDLAHTPSQLEGLDPATEARYRREGARFIFDV
GTRLGLHYDTLATGIIYFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTA
RSLLNDVQFGQFGDDPKEEVMVLERILLQTIKFDLQVEHPYQFLLKYAKQLKGDKNKIQK
LVQMAWTFVNDSLCTTLSLQWEPEIIAVAVMYLAGRLCKFEIQEWTSKPMYRRWWEQFVQ
DVPVDVLEDICHQILDLYSQGKQQMPHHTPHQLQQPPSLQPTPQVPQVQQSQPSQSSEPS
QPQQKDPQQPAQQQQPAQQPKKPSPQPSSPRQVKRAVVVSPKEENKAAEPPPPKIPKIET
THPPLPPAHPPPDRKPPLAAALGEAEPPGPVDATDLPKVQIPPPAHPAPVHQPPPLPHRP
PPPPPSSYMTGMSTTSSYMSGEGYQSLQSMMKTEGPSYGALPPAYGPPAHLPYHPHVYPP
NPPPPPVPPPPASFPPPAIPPPTPGYPPPPPTYNPNFPPPPPRLPPTHAVPPHPPPGLGL
PPASYPPPAVPPGGQPPVPPPIPPPGMPPVGGLGRAAWMR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R6K1	0.492	0.492	2.046E-60	580	1.000	1.000	A0A024R6K1.pdb.gz
2	AFDB:O88874	0.481	0.503	4.144E-55	554	0.916	0.958	O88874.pdb.gz	CCNK_MOUSE Cyclin-K OS=Mus musculus OX=10090 GN=Ccnk PE=1 SV=3
3	AFDB:Q961D1	0.420	0.607	1.004E-25	400	0.340	0.492	Q961D1.pdb.gz	Q961D1_DROME Cyclin K, isoform A OS=Drosophila melanogaster OX=7227 GN=CycK PE=1 SV=1
4	AFDB:O60583	0.375	0.300	4.694E-15	730	0.191	0.152	O60583.pdb.gz	CCNT2_HUMAN Cyclin-T2 OS=Homo sapiens OX=9606 GN=CCNT2 PE=1 SV=2
5	AFDB:Q7TQK0	0.372	0.301	1.807E-14	723	0.229	0.184	Q7TQK0.pdb.gz	CCNT2_MOUSE Cyclin-T2 OS=Mus musculus OX=10090 GN=Ccnt2 PE=1 SV=1
6	PDB:6gzhB	0.361	0.812	9.605E-13	252	0.134	0.310	6gzhB.pdb.gz	Small Molecules Co-targeting CKI alpha and the Transcriptional Kinases CDK7/9 Control AML in Preclinical Models.
7	PDB:5hbhB	0.356	0.737	4.624E-9	270	0.122	0.263	5hbhB.pdb.gz	Discovery of Potent, Selective, and Orally Bioavailable Small-Molecule Modulators of the Mediator Complex-Associated Kinases CDK8 and CDK19.
8	PDB:7kpvB	0.309	0.589	2.122E-7	290	0.098	0.197	7kpvB.pdb.gz
9	PDB:7jv7B	0.331	0.594	6.574E-7	310	0.093	0.174	7jv7B.pdb.gz
10	PDB:1zp2A	0.311	0.743	7.490E-7	227	0.091	0.233	1zp2A.pdb.gz
11	PDB:2w96A	0.308	0.662	1.638E-6	249	0.069	0.161	2w96A.pdb.gz
12	PDB:7egb9	0.326	0.624	4.652E-6	287	0.083	0.167	7egb9.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
13	PDB:7kueB	0.307	0.744	6.307E-6	225	0.072	0.187	7kueB.pdb.gz	Structure of TFIIK for phosphorylation of CTD of RNA polymerase II.
14	PDB:7nj0C	0.303	0.621	3.438E-5	270	0.059	0.126	7nj0C.pdb.gz	Structural basis of human separase regulation by securin and CDK1-cyclin B1.
15	PDB:7b5lY	0.289	0.614	3.751E-5	253	0.072	0.166	7b5lY.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
16	AFDB:Q8WWL7	0.300	0.130	8.822E-4	1395	0.072	0.030	Q8WWL7.pdb.gz	CCNB3_HUMAN G2/mitotic-specific cyclin-B3 OS=Homo sapiens OX=9606 GN=CCNB3 PE=1 SV=2
17	AFDB:Q385F2	0.066	0.043	6.256E-2	1231	0.183	0.086	Q385F2.pdb.gz	Q385F2_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4040 PE=3 SV=1
18	AFDB:P23385	0.086	0.056	2.024E-1	1199	0.157	0.076	P23385.pdb.gz	GRM1_RAT Metabotropic glutamate receptor 1 OS=Rattus norvegicus OX=10116 GN=Grm1 PE=1 SV=1
19	AFDB:F1Q4L8	0.072	0.055	2.306E-1	908	0.140	0.089	F1Q4L8.pdb.gz	F1Q4L8_DANRE CCR4-NOT transcription complex subunit 3 OS=Danio rerio OX=7955 GN=cnot3 PE=3 SV=2
20	AFDB:F4J0E6	0.066	0.052	5.268E-1	674	0.086	0.074	F4J0E6.pdb.gz	F4J0E6_ARATH Transmembrane protein, putative (DUF1216) OS=Arabidopsis thaliana OX=3702 GN=At3g28780 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1QMB9	0.0	537	425	0.483	0.659	CCNK_DANRE Cyclin-K OS=Danio rerio OX=7955 GN=ccnk PE=2 SV=3
2	G3V5E1	0.0	769	378	0.641	0.984	G3V5E1_HUMAN Cyclin K OS=Homo sapiens OX=9606 GN=CCNK PE=1 SV=1
3	O75909	0.0	1150	580	1.000	1.000	CCNK_HUMAN Cyclin-K OS=Homo sapiens OX=9606 GN=CCNK PE=1 SV=2
4	O88874	0.0	774	554	0.762	0.798	CCNK_MOUSE Cyclin-K OS=Mus musculus OX=10090 GN=Ccnk PE=1 SV=3
5	G3V2Q3	3.16e-176	499	227	0.391	1.000	G3V2Q3_HUMAN Cyclin K (Fragment) OS=Homo sapiens OX=9606 GN=CCNK PE=1 SV=1
6	Q961D1	3.20e-128	383	400	0.295	0.427	Q961D1_DROME Cyclin K, isoform A OS=Drosophila melanogaster OX=7227 GN=CycK PE=1 SV=1
7	O17869	1.20e-49	174	252	0.172	0.397	O17869_CAEEL Cyclin-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ccnk-1 PE=1 SV=2
8	F4KD43	3.45e-40	156	590	0.157	0.154	F4KD43_ARATH Cyclin family protein OS=Arabidopsis thaliana OX=3702 GN=CYCT1:5 PE=1 SV=1
9	Q8GYM6	1.85e-39	153	541	0.150	0.161	CCT14_ARATH Cyclin-T1-4 OS=Arabidopsis thaliana OX=3702 GN=CYCT1-4 PE=1 SV=1
10	A0A0G2JXM2	2.09e-39	155	724	0.140	0.112	A0A0G2JXM2_RAT Cyclin-T1 OS=Rattus norvegicus OX=10116 GN=Ccnt1 PE=1 SV=2
11	Q9QWV9	2.75e-39	155	724	0.140	0.112	CCNT1_MOUSE Cyclin-T1 OS=Mus musculus OX=10090 GN=Ccnt1 PE=1 SV=3
12	O60563	1.78e-38	153	726	0.147	0.117	CCNT1_HUMAN Cyclin-T1 OS=Homo sapiens OX=9606 GN=CCNT1 PE=1 SV=1
13	Q7TQK0	5.61e-38	151	723	0.143	0.115	CCNT2_MOUSE Cyclin-T2 OS=Mus musculus OX=10090 GN=Ccnt2 PE=1 SV=1
14	O96433	2.72e-37	150	1097	0.126	0.067	CCNT_DROME Cyclin-T OS=Drosophila melanogaster OX=7227 GN=CycT PE=1 SV=2
15	O60583	3.85e-36	146	730	0.131	0.104	CCNT2_HUMAN Cyclin-T2 OS=Homo sapiens OX=9606 GN=CCNT2 PE=1 SV=2
16	D3ZC98	1.87e-33	137	663	0.121	0.106	D3ZC98_RAT Cyclin T1 OS=Rattus norvegicus OX=10116 GN=Ccnt1 PE=3 SV=1
17	O74627	4.86e-33	131	342	0.138	0.234	CG1C_SCHPO Cyclin pch1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pch1 PE=1 SV=1
18	Q5I0H5	7.42e-28	119	520	0.147	0.163	CCNL2_RAT Cyclin-L2 OS=Rattus norvegicus OX=10116 GN=Ccnl2 PE=1 SV=2
19	A0A8I6G622	7.52e-28	112	181	0.100	0.320	A0A8I6G622_RAT Cyclin T1 OS=Rattus norvegicus OX=10116 GN=Ccnt1 PE=1 SV=1
20	Q9JJA7	1.49e-27	119	518	0.147	0.164	CCNL2_MOUSE Cyclin-L2 OS=Mus musculus OX=10090 GN=Ccnl2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19268 CIS_TMP	1.4e+02	13.2	Contractile injection system tape measure protein
2	PF02984 Cyclin_C	0.36	22.3	Cyclin, C-terminal domain
3	PF00134 Cyclin_N	5.7e-11	53.7	Cyclin, N-terminal domain
4	PF17815 PDZ_3	1.2e+02	14.0	PDZ domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000374529

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000181839	0.999	Cyclin-dependent kinase 13
2	9606.ENSP00000362361	0.999	Cyclin-dependent kinase 9
3	9606.ENSP00000398880	0.999	Cyclin-dependent kinase 12
4	9606.ENSP00000480158	0.976	DNA-directed RNA polymerase II subunit RPB1
5	9606.ENSP00000256443	0.966	Cyclin-dependent kinase 7
6	9606.ENSP00000256897	0.956	Cyclin-H
7	9606.ENSP00000470252	0.936	Transcription elongation factor SPT5
8	9606.ENSP00000269305	0.917	Cellular tumor antigen p53
9	9606.ENSP00000370938	0.911	Cyclin-dependent kinase 8
10	9606.ENSP00000266970	0.910	Cyclin-dependent kinase 2
11	9606.ENSP00000332973	0.903	Mothers against decapentaplegic homolog 3
12	9606.ENSP00000341551	0.902	Mothers against decapentaplegic homolog 4
13	9606.ENSP00000262160	0.900	Mothers against decapentaplegic homolog 2
14	9606.ENSP00000378699	0.895	Cyclin-dependent kinase 1
15	9606.ENSP00000363836	0.888	Cyclin-Y
16	9606.ENSP00000257904	0.886	Cyclin-dependent kinase 4
17	9606.ENSP00000484525	0.879	RNA polymerase II subunit A C-terminal domain phosphatase
18	9606.ENSP00000261245	0.877	CDK-activating kinase assembly factor MAT1
19	9606.ENSP00000369390	0.877	Cyclin-dependent kinase 14
20	9606.ENSP00000377969	0.871	General transcription factor IIF subunit 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0097472	0.998	cyclin-dependent protein kinase activity
GO:0019899	0.996	enzyme binding
GO:0008353	0.995	RNA polymerase II CTD heptapeptide repeat kinase activity
GO:0019901	0.799	protein kinase binding
GO:0004693	0.762	cyclin-dependent protein serine/threonine kinase activity
GO:1901363	0.531	heterocyclic compound binding
GO:0097159	0.487	organic cyclic compound binding
GO:0003676	0.481	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0009987	0.971	cellular process
GO:0019222	0.959	regulation of metabolic process
GO:0031323	0.952	regulation of cellular metabolic process
GO:0071704	0.951	organic substance metabolic process
GO:0080090	0.951	regulation of primary metabolic process
GO:0060255	0.951	regulation of macromolecule metabolic process
GO:0044238	0.950	primary metabolic process
GO:0051171	0.950	regulation of nitrogen compound metabolic process
GO:0006807	0.944	nitrogen compound metabolic process
GO:0044237	0.941	cellular metabolic process
GO:0043170	0.940	macromolecule metabolic process
GO:0019219	0.854	regulation of nucleobase-containing compound metabolic process
GO:0048518	0.844	positive regulation of biological process
GO:0051252	0.844	regulation of RNA metabolic process
GO:0010468	0.838	regulation of gene expression
GO:0006725	0.826	cellular aromatic compound metabolic process
GO:1901360	0.825	organic cyclic compound metabolic process
GO:0046483	0.825	heterocycle metabolic process
GO:0034641	0.825	cellular nitrogen compound metabolic process
GO:0090304	0.824	nucleic acid metabolic process
GO:0010467	0.816	gene expression
GO:0016070	0.814	RNA metabolic process
GO:0048522	0.770	positive regulation of cellular process
GO:0010556	0.728	regulation of macromolecule biosynthetic process
GO:0031326	0.728	regulation of cellular biosynthetic process
GO:0097659	0.716	nucleic acid-templated transcription
GO:0006366	0.714	transcription by RNA polymerase II
GO:2001141	0.646	regulation of RNA biosynthetic process
GO:0006355	0.642	regulation of DNA-templated transcription
GO:0009893	0.637	positive regulation of metabolic process
GO:0051254	0.625	positive regulation of RNA metabolic process
GO:0006357	0.620	regulation of transcription by RNA polymerase II
GO:0051726	0.567	regulation of cell cycle
GO:1902680	0.508	positive regulation of RNA biosynthetic process
GO:0045893	0.504	positive regulation of DNA-templated transcription
GO:0045944	0.486	positive regulation of transcription by RNA polymerase II
GO:0048519	0.477	negative regulation of biological process
GO:0043412	0.467	macromolecule modification
GO:0048523	0.456	negative regulation of cellular process
GO:0036211	0.442	protein modification process
GO:0051246	0.423	regulation of protein metabolic process
GO:0050896	0.415	response to stimulus
GO:1904029	0.410	regulation of cyclin-dependent protein kinase activity
GO:0000079	0.403	regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0016310	0.337	phosphorylation
GO:0032784	0.337	regulation of DNA-templated transcription elongation
GO:0006468	0.325	protein phosphorylation
GO:0034243	0.305	regulation of transcription elongation by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.988	protein-containing complex
GO:1990234	0.895	transferase complex
GO:0140513	0.867	nuclear protein-containing complex
GO:0061695	0.844	transferase complex, transferring phosphorus-containing groups
GO:1902554	0.606	serine/threonine protein kinase complex
GO:0000307	0.515	cyclin-dependent protein kinase holoenzyme complex
GO:0005737	0.319	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10216	0.995	[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase]
EC:2.7.11.23	0.995	[RNA-polymerase]-subunit kinase.
EC:2.7.11.22	0.762	cyclin-dependent kinase.

[back to server]