StarFunc result for job id O75912

User Input

>input (1065 residues)
MDAAGRGCHLLPLPAARGPARAPAAAAAAAASPPGPCSGAACAPSAAAGAGAMNPSSSAG
EEKGATGGSSSSGSGAGSCCLGAEGGADPRGAGSAAAAGAAALDEPAAAGQKEKDEALEE
KLRNLTFRKQVSYRKAISRAGLQHLAPAHPLSLPVANGPAKEPRATLDWSENAVNGEHLW
LETNVSGDLCYLGEENCQVRFAKSALRRKCAVCKIVVHTACIEQLEKINFRCKPTFREGG
SRSPRENFVRHHWVHRRRQEGKCKQCGKGFQQKFSFHSKEIVAISCSWCKQAFHNKVTCF
MLHHIEEPCSLGAHAAVIVPPTWIIKVKKPQNSLKASNRKKKRTSFKRKASKRGMEQENK
GRPFVIKPISSPLMKPLLVFVNPKSGGNQGTKVLQMFMWYLNPRQVFDLSQEGPKDALEL
YRKVPNLRILACGGDGTVGWILSILDELQLSPQPPVGVLPLGTGNDLARTLNWGGGYTDE
PVSKILCQVEDGTVVQLDRWNLHVERNPDLPPEELEDGVCKLPLNVFNNYFSLGFDAHVT
LEFHESREANPEKFNSRFRNKMFYAGAAFSDFLQRSSRDLSKHVKVVCDGTDLTPKIQEL
KFQCIVFLNIPRYCAGTMPWGNPGDHHDFEPQRHDDGYIEVIGFTMASLAALQVGGHGER
LHQCREVMLLTYKSIPMQVDGEPCRLAPAMIRISLRNQANMVQKSKRRTSMPLLNDPQSV
PDRLRIRVNKISLQDYEGFHYDKEKLREASISDWLRTIAGELVQSFGAIPLGILVVRGDC
DLETCRMYIDRLQEDLQSVSSGSQRVHYQDHETSFPRALSAQRLSPRWCFLDDRSQEHLH
FVMEISQDEIFILDPDMVVSQPAGTPPGMPDLVVEQASGISDWWNPALRKRMLSDSGLGM
IAPYYEDSDLKDLSHSRVLQSPVSSEDHAILQAVIAGDLMKLIESYKNGGSLLIQGPDHC
SLLHYAAKTGNGEIVKYILDHGPSELLDMADSETGETALHKAACQRNRAVCQLLVDAGAS
LRKTDSKGKTPQERAQQAGDPDLAAYLESRQNYKVIGHEDLETAV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3YWQ0	0.639	0.635	0.000	1071	0.936	0.931	D3YWQ0.pdb.gz	DGKI_MOUSE Diacylglycerol kinase iota OS=Mus musculus OX=10090 GN=Dgki PE=1 SV=1
2	AFDB:F1MAB7	0.566	0.574	0.000	1050	0.942	0.955	F1MAB7.pdb.gz	DGKI_RAT Diacylglycerol kinase iota OS=Rattus norvegicus OX=10116 GN=Dgki PE=1 SV=1
3	AFDB:O08560	0.522	0.597	0.000	929	0.541	0.620	O08560.pdb.gz	DGKZ_RAT Diacylglycerol kinase zeta OS=Rattus norvegicus OX=10116 GN=Dgkz PE=1 SV=1
4	AFDB:Q09103	0.494	0.379	4.496E-89	1457	0.369	0.270	Q09103.pdb.gz	DGK2_DROME Eye-specific diacylglycerol kinase OS=Drosophila melanogaster OX=7227 GN=rdgA PE=2 SV=2
5	AFDB:Q9Y6T7	0.425	0.558	2.734E-51	804	0.178	0.236	Q9Y6T7.pdb.gz	DGKB_HUMAN Diacylglycerol kinase beta OS=Homo sapiens OX=9606 GN=DGKB PE=1 SV=2
6	AFDB:P49619	0.417	0.556	1.201E-49	791	0.179	0.241	P49619.pdb.gz	DGKG_HUMAN Diacylglycerol kinase gamma OS=Homo sapiens OX=9606 GN=DGKG PE=1 SV=3
7	AFDB:P49620	0.425	0.569	3.425E-48	788	0.181	0.245	P49620.pdb.gz	DGKG_RAT Diacylglycerol kinase gamma OS=Rattus norvegicus OX=10116 GN=Dgkg PE=1 SV=1
8	AFDB:P23743	0.426	0.610	1.187E-47	735	0.170	0.246	P23743.pdb.gz	DGKA_HUMAN Diacylglycerol kinase alpha OS=Homo sapiens OX=9606 GN=DGKA PE=1 SV=3
9	AFDB:O88673	0.412	0.592	6.832E-46	730	0.173	0.252	O88673.pdb.gz	DGKA_MOUSE Diacylglycerol kinase alpha OS=Mus musculus OX=10090 GN=Dgka PE=1 SV=2
10	AFDB:E9PUQ8	0.407	0.357	9.394E-36	1220	0.182	0.159	E9PUQ8.pdb.gz	DGKD_MOUSE Diacylglycerol kinase delta OS=Mus musculus OX=10090 GN=Dgkd PE=1 SV=1
11	PDB:4l02A	0.212	0.561	7.715E-11	360	0.056	0.167	4l02A.pdb.gz	Structure guided design of a series of sphingosine kinase (SphK) inhibitors.
12	PDB:7cgpB	0.197	0.518	6.347E-10	345	0.050	0.154	7cgpB.pdb.gz
13	PDB:2bonB	0.194	0.681	1.428E-9	265	0.053	0.211	2bonB.pdb.gz	Crystal Structure of Yegs, a Homologue to the Mammalian Diacylglycerol Kinases, Reveals a Novel Regulatory Metal Binding Site.
14	PDB:2bonA	0.203	0.669	1.679E-9	287	0.054	0.199	2bonA.pdb.gz	Crystal Structure of Yegs, a Homologue to the Mammalian Diacylglycerol Kinases, Reveals a Novel Regulatory Metal Binding Site.
15	PDB:2qv7A	0.190	0.575	2.451E-9	303	0.052	0.182	2qv7A.pdb.gz	Analysis of the Staphylococcus aureus DgkB Structure Reveals a Common Catalytic Mechanism for the Soluble Diacylglycerol Kinases.
16	PDB:8cs9A	0.111	0.149	1.020E-7	796	0.032	0.043	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
17	PDB:3ehqA	0.105	0.584	6.405E-7	182	0.029	0.170	3ehqA.pdb.gz
18	PDB:1bd8A	0.107	0.653	1.225E-6	156	0.035	0.237	1bd8A.pdb.gz
19	PDB:6jd6B	0.113	0.576	2.343E-6	192	0.023	0.130	6jd6B.pdb.gz
20	PDB:4bszB	0.115	0.737	2.473E-6	150	0.038	0.267	4bszB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3YWQ0	0.0	1894	1071	0.933	0.928	DGKI_MOUSE Diacylglycerol kinase iota OS=Mus musculus OX=10090 GN=Dgki PE=1 SV=1
2	E9PNL8	0.0	904	707	0.434	0.653	E9PNL8_HUMAN Diacylglycerol kinase OS=Homo sapiens OX=9606 GN=DGKZ PE=1 SV=1
3	F1MAB7	0.0	1917	1050	0.938	0.951	DGKI_RAT Diacylglycerol kinase iota OS=Rattus norvegicus OX=10116 GN=Dgki PE=1 SV=1
4	O08560	0.0	1139	929	0.546	0.625	DGKZ_RAT Diacylglycerol kinase zeta OS=Rattus norvegicus OX=10116 GN=Dgkz PE=1 SV=1
5	O75912	0.0	2211	1065	1.000	1.000	DGKI_HUMAN Diacylglycerol kinase iota OS=Homo sapiens OX=9606 GN=DGKI PE=1 SV=1
6	Q09103	0.0	687	1457	0.368	0.269	DGK2_DROME Eye-specific diacylglycerol kinase OS=Drosophila melanogaster OX=7227 GN=rdgA PE=2 SV=2
7	Q13574	0.0	1156	928	0.544	0.624	DGKZ_HUMAN Diacylglycerol kinase zeta OS=Homo sapiens OX=9606 GN=DGKZ PE=1 SV=4
8	Q80UP3	0.0	1137	929	0.539	0.618	DGKZ_MOUSE Diacylglycerol kinase zeta OS=Mus musculus OX=10090 GN=Dgkz PE=1 SV=2
9	Q6NS52	7.49e-91	310	802	0.189	0.251	DGKB_MOUSE Diacylglycerol kinase beta OS=Mus musculus OX=10090 GN=Dgkb PE=1 SV=2
10	Q03603	2.14e-90	309	795	0.183	0.245	DGK3_CAEEL Probable diacylglycerol kinase 3 OS=Caenorhabditis elegans OX=6239 GN=dgk-3 PE=3 SV=3
11	P49620	7.18e-90	308	788	0.177	0.240	DGKG_RAT Diacylglycerol kinase gamma OS=Rattus norvegicus OX=10116 GN=Dgkg PE=1 SV=1
12	P49621	1.11e-89	307	801	0.188	0.250	DGKB_RAT Diacylglycerol kinase beta OS=Rattus norvegicus OX=10116 GN=Dgkb PE=1 SV=1
13	Q9Y6T7	2.19e-89	306	804	0.190	0.251	DGKB_HUMAN Diacylglycerol kinase beta OS=Homo sapiens OX=9606 GN=DGKB PE=1 SV=2
14	Q91WG7	3.50e-86	297	788	0.177	0.239	DGKG_MOUSE Diacylglycerol kinase gamma OS=Mus musculus OX=10090 GN=Dgkg PE=1 SV=1
15	P20192	4.82e-86	296	734	0.188	0.272	DGKA_PIG Diacylglycerol kinase alpha OS=Sus scrofa OX=9823 GN=DGKA PE=1 SV=1
16	P49619	2.15e-85	295	791	0.173	0.233	DGKG_HUMAN Diacylglycerol kinase gamma OS=Homo sapiens OX=9606 GN=DGKG PE=1 SV=3
17	P23743	2.73e-84	291	735	0.181	0.263	DGKA_HUMAN Diacylglycerol kinase alpha OS=Homo sapiens OX=9606 GN=DGKA PE=1 SV=3
18	P51556	6.79e-77	270	727	0.180	0.264	DGKA_RAT Diacylglycerol kinase alpha OS=Rattus norvegicus OX=10116 GN=Dgka PE=1 SV=1
19	O88673	4.69e-76	268	730	0.177	0.259	DGKA_MOUSE Diacylglycerol kinase alpha OS=Mus musculus OX=10090 GN=Dgka PE=1 SV=2
20	A1L4Q0	5.30e-66	235	567	0.159	0.298	A1L4Q0_HUMAN Diacylglycerol kinase OS=Homo sapiens OX=9606 GN=DGKE PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	0.0033	29.0	Ankyrin repeat
2	PF12796 Ank_2	5.1e-09	47.9	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	0.00082	30.5	Ankyrin repeat
4	PF13637 Ank_4	0.0013	30.5	Ankyrin repeats (many copies)
5	PF13857 Ank_5	0.00031	32.2	Ankyrin repeats (many copies)
6	PF00130 C1_1	2.7e-10	51.3	Phorbol esters/diacylglycerol binding domain (C1 domain)
7	PF00609 DAGK_acc	6.2e-44	161.6	Diacylglycerol kinase accessory domain
8	PF00781 DAGK_cat	3.6e-26	102.7	Diacylglycerol kinase catalytic domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000288490

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000384192	0.863	Ras guanyl-releasing protein 3
2	9606.ENSP00000260402	0.853	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2
3	9606.ENSP00000443631	0.805	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3
4	9606.ENSP00000419879	0.797	Phosphatidate cytidylyltransferase 2
5	9606.ENSP00000388631	0.790	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4
6	9606.ENSP00000295887	0.785	Phosphatidate cytidylyltransferase 1
7	9606.ENSP00000263088	0.778	Phospholipase D2
8	9606.ENSP00000367762	0.768	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4
9	9606.ENSP00000338185	0.767	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1
10	9606.ENSP00000478061	0.766	Myristoylated alanine-rich C-kinase substrate
11	9606.ENSP00000285518	0.763	1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon
12	9606.ENSP00000360431	0.763	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1
13	9606.ENSP00000406674	0.756	2-acylglycerol O-acyltransferase 1
14	9606.ENSP00000342793	0.755	Phospholipase D1
15	9606.ENSP00000266505	0.748	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1
16	9606.ENSP00000479636	0.736	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3
17	9606.ENSP00000430344	0.733	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1
18	9606.ENSP00000355607	0.730	Glyceronephosphate O-acyltransferase
19	9606.ENSP00000198801	0.726	2-acylglycerol O-acyltransferase 2
20	9606.ENSP00000244007	0.726	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004143	1.000	diacylglycerol kinase activity
GO:0019899	0.755	enzyme binding
GO:0098772	0.333	molecular function regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0071704	0.987	organic substance metabolic process
GO:0065007	0.984	biological regulation
GO:0044238	0.984	primary metabolic process
GO:0044237	0.978	cellular metabolic process
GO:0006629	0.961	lipid metabolic process
GO:0044255	0.947	cellular lipid metabolic process
GO:0030168	0.939	platelet activation
GO:0006793	0.936	phosphorus metabolic process
GO:0006796	0.913	phosphate-containing compound metabolic process
GO:0050789	0.792	regulation of biological process
GO:0050794	0.772	regulation of cellular process
GO:0046486	0.722	glycerolipid metabolic process
GO:0030258	0.681	lipid modification
GO:0006644	0.630	phospholipid metabolic process
GO:0016310	0.610	phosphorylation
GO:0006650	0.566	glycerophospholipid metabolic process
GO:0009058	0.527	biosynthetic process
GO:0051716	0.513	cellular response to stimulus
GO:0023052	0.492	signaling
GO:0007154	0.491	cell communication
GO:0045017	0.487	glycerolipid biosynthetic process
GO:0007165	0.405	signal transduction
GO:0046474	0.371	glycerophospholipid biosynthetic process
GO:0046473	0.303	phosphatidic acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0016020	0.998	membrane
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0012505	0.993	endomembrane system
GO:0045202	0.989	synapse
GO:0005634	0.981	nucleus
GO:0005886	0.974	plasma membrane
GO:0005829	0.955	cytosol
GO:0032991	0.953	protein-containing complex
GO:0098978	0.930	glutamatergic synapse
GO:0098794	0.914	postsynapse
GO:0120025	0.838	plasma membrane bounded cell projection
GO:0043005	0.802	neuron projection
GO:0099572	0.757	postsynaptic specialization
GO:0032279	0.755	asymmetric synapse
GO:0014069	0.751	postsynaptic density
GO:0031982	0.741	vesicle
GO:0036477	0.729	somatodendritic compartment
GO:0098685	0.686	Schaffer collateral - CA1 synapse
GO:0097447	0.669	dendritic tree
GO:0030425	0.656	dendrite
GO:0031981	0.420	nuclear lumen
GO:0031090	0.401	organelle membrane
GO:0005654	0.324	nucleoplasm
GO:0048471	0.307	perinuclear region of cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10272	1.000	a 1,2-diacyl-sn-glycerol + ATP = a 1,2-diacyl-sn-glycero-3-phosphate + ADP + H(+)
EC:2.7.1.107	1.000	diacylglycerol kinase (ATP).

[back to server]