StarFunc result for job id O75923

User Input

>input (2080 residues)
MLRVFILYAENVHTPDTDISDAYCSAVFAGVKKRTKVIKNSVNPVWNEGFEWDLKGIPLD
QGSELHVVVKDHETMGRNRFLGEAKVPLREVLATPSLSASFNAPLLDTKKQPTGASLVLQ
VSYTPLPGAVPLFPPPTPLEPSPTLPDLDVVADTGGEEDTEDQGLTGDEAEPFLDQSGGP
GAPTTPRKLPSRPPPHYPGIKRKRSAPTSRKLLSDKPQDFQIRVQVIEGRQLPGVNIKPV
VKVTAAGQTKRTRIHKGNSPLFNETLFFNLFDSPGELFDEPIFITVVDSRSLRTDALLGE
FRMDVGTIYREPRHAYLRKWLLLSDPDDFSAGARGYLKTSLCVLGPGDEAPLERKDPSED
KEDIESNLLRPTGVALRGAHFCLKVFRAEDLPQMDDAVMDNVKQIFGFESNKKNLVDPFV
EVSFAGKMLCSKILEKTANPQWNQNITLPAMFPSMCEKMRIRIIDWDRLTHNDIVATTYL
SMSKISAPGGEIEEEPAGAVKPSKASDLDDYLGFLPTFGPCYINLYGSPREFTGFPDPYT
ELNTGKGEGVAYRGRLLLSLETKLVEHSEQKVEDLPADDILRVEKYLRRRKYSLFAAFYS
ATMLQDVDDAIQFEVSIGNYGNKFDMTCLPLASTTQYSRAVFDGCHYYYLPWGNVKPVVV
LSSYWEDISHRIETQNQLLGIADRLEAGLEQVHLALKAQCSTEDVDSLVAQLTDELIAGC
SQPLGDIHETPSATHLDQYLYQLRTHHLSQITEAALALKLGHSELPAALEQAEDWLLRLR
ALAEEPQNSLPDIVIWMLQGDKRVAYQRVPAHQVLFSRRGANYCGKNCGKLQTIFLKYPM
EKVPGARMPVQIRVKLWFGLSVDEKEFNQFAEGKLSVFAETYENETKLALVGNWGTTGLT
YPKFSDVTGKIKLPKDSFRPSAGWTWAGDWFVCPEKTLLHDMDAGHLSFVEEVFENQTRL
PGGQWIYMSDNYTDVNGEKVLPKDDIECPLGWKWEDEEWSTDLNRAVDEQGWEYSITIPP
ERKPKHWVPAEKMYYTHRRRRWVRLRRRDLSQMEALKRHRQAEAEGEGWEYASLFGWKFH
LEYRKTDAFRRRRWRRRMEPLEKTGPAAVFALEGALGGVMDDKSEDSMSVSTLSFGVNRP
TISCIFDYGNRYHLRCYMYQARDLAAMDKDSFSDPYAIVSFLHQSQKTVVVKNTLNPTWD
QTLIFYEIEIFGEPATVAEQPPSIVVELYDHDTYGADEFMGRCICQPSLERMPRLAWFPL
TRGSQPSGELLASFELIQREKPAIHHIPGFEVQETSRILDESEDTDLPYPPPQREANIYM
VPQNIKPALQRTAIEILAWGLRNMKSYQLANISSPSLVVECGGQTVQSCVIRNLRKNPNF
DICTLFMEVMLPREELYCPPITVKVIDNRQFGRRPVVGQCTIRSLESFLCDPYSAESPSP
QGGPDDVSLLSPGEDVLIDIDDKEPLIPIQEEEFIDWWSKFFASIGEREKCGSYLEKDFD
TLKVYDTQLENVEAFEGLSDFCNTFKLYRGKTQEETEDPSVIGEFKGLFKIYPLPEDPAI
PMPPRQFHQLAAQGPQECLVRIYIVRAFGLQPKDPNGKCDPYIKISIGKKSVSDQDNYIP
CTLEPVFGKMFELTCTLPLEKDLKITLYDYDLLSKDEKIGETVVDLENRLLSKFGARCGL
PQTYCVSGPNQWRDQLRPSQLLHLFCQQHRVKAPVYRTDRVMFQDKEYSIEEIEAGRIPN
PHLGPVEERLALHVLQQQGLVPEHVESRPLYSPLQPDIEQGKLQMWVDLFPKALGRPGPP
FNITPRRARRFFLRCIIWNTRDVILDDLSLTGEKMSDIYVKGWMIGFEEHKQKTDVHYRS
LGGEGNFNWRFIFPFDYLPAEQVCTIAKKDAFWRLDKTESKIPARVVFQIWDNDKFSFDD
FLGSLQLDLNRMPKPAKTAKKCSLDQLDDAFHPEWFVSLFEQKTVKGWWPCVAEEGEKKI
LAGKLEMTLEIVAESEHEERPAGQGRDEPNMNPKLEDPRRPDTSFLWFTSPYKTMKFILW
RRFRWAIILFIILFILLLFLAIFIYAFPNYAAMKLVKPFS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B7Z0E5	0.456	0.557	0.000	1647	0.186	0.234	B7Z0E5.pdb.gz	B7Z0E5_DROME Misfire, isoform F OS=Drosophila melanogaster OX=7227 GN=mfr PE=4 SV=1
2	AFDB:E0CZ42	0.527	0.579	0.000	1862	0.314	0.351	E0CZ42.pdb.gz	E0CZ42_MOUSE Fer-1-like 6 (C. elegans) OS=Mus musculus OX=10090 GN=Fer1l6 PE=1 SV=1
3	AFDB:E7F4H1	0.932	0.924	0.000	2097	0.685	0.679	E7F4H1.pdb.gz	E7F4H1_DANRE Dysferlin OS=Danio rerio OX=7955 GN=si:rp71-50c18.1 PE=2 SV=2
4	AFDB:E7FGH7	0.494	0.566	0.000	1790	0.300	0.349	E7FGH7.pdb.gz
5	AFDB:F8W4A8	0.512	0.591	0.000	1773	0.307	0.360	F8W4A8.pdb.gz	F8W4A8_DANRE Otoferlin b OS=Danio rerio OX=7955 GN=otofb PE=4 SV=1
6	AFDB:Q17388	0.618	0.630	0.000	2034	0.236	0.241	Q17388.pdb.gz	FER1_CAEEL Sperm vesicle fusion protein fer-1 OS=Caenorhabditis elegans OX=6239 GN=fer-1 PE=2 SV=1
7	AFDB:Q5SPC5	0.572	0.595	0.000	1992	0.325	0.339	Q5SPC5.pdb.gz	OTOF_DANRE Otoferlin OS=Danio rerio OX=7955 GN=otof PE=3 SV=1
8	AFDB:Q9ERC5	0.528	0.548	0.000	1993	0.328	0.342	Q9ERC5.pdb.gz	OTOF_RAT Otoferlin OS=Rattus norvegicus OX=10116 GN=Otof PE=1 SV=2
9	AFDB:Q9ESD7	0.820	0.816	0.000	2090	0.938	0.933	Q9ESD7.pdb.gz	DYSF_MOUSE Dysferlin OS=Mus musculus OX=10090 GN=Dysf PE=1 SV=3
10	AFDB:Q9ESF1	0.528	0.547	0.000	1997	0.331	0.345	Q9ESF1.pdb.gz	OTOF_MOUSE Otoferlin OS=Mus musculus OX=10090 GN=Otof PE=1 SV=1
11	PDB:6kxkD	0.051	0.175	1.895E-8	553	0.025	0.096	6kxkD.pdb.gz	Crystal Structure of an Arabidopsis Copine providing insights into this protein family
12	PDB:5iz5B	0.057	0.153	3.737E-8	746	0.017	0.047	5iz5B.pdb.gz
13	PDB:5iz5A	0.056	0.150	1.086E-7	757	0.018	0.049	5iz5A.pdb.gz
14	PDB:5a50A	0.051	0.560	4.886E-7	165	0.016	0.206	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
15	PDB:5ixcA	0.058	0.167	5.384E-7	684	0.016	0.050	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
16	PDB:5a52A	0.052	0.603	1.289E-6	154	0.014	0.188	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
17	PDB:5izrC	0.054	0.161	3.240E-6	659	0.017	0.053	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
18	PDB:1cjyA	0.049	0.155	5.524E-6	633	0.014	0.047	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
19	PDB:4rj9A	0.050	0.531	5.798E-6	161	0.015	0.193	4rj9A.pdb.gz
20	PDB:3nsjA	0.052	0.196	1.200E-5	530	0.013	0.053	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4A6X1	0.0	3779	2029	0.899	0.922	D4A6X1_RAT Dysferlin OS=Rattus norvegicus OX=10116 GN=Dysf PE=3 SV=2
2	E0CZ42	0.0	704	1862	0.194	0.217	E0CZ42_MOUSE Fer-1-like 6 (C. elegans) OS=Mus musculus OX=10090 GN=Fer1l6 PE=1 SV=1
3	E7F4H1	0.0	2939	2097	0.686	0.680	E7F4H1_DANRE Dysferlin OS=Danio rerio OX=7955 GN=si:rp71-50c18.1 PE=2 SV=2
4	F1QIS3	0.0	2899	2088	0.680	0.677	F1QIS3_DANRE Dysferlin isoform X9 OS=Danio rerio OX=7955 GN=si:rp71-50c18.1 PE=3 SV=3
5	F6IA09	0.0	2862	2088	0.673	0.670	F6IA09_DANRE Dysferlin OS=Danio rerio OX=7955 GN=si:rp71-50c18.1 PE=2 SV=1
6	F8W4A8	0.0	693	1773	0.192	0.225	F8W4A8_DANRE Otoferlin b OS=Danio rerio OX=7955 GN=otofb PE=4 SV=1
7	O75923	0.0	4304	2080	1.000	1.000	DYSF_HUMAN Dysferlin OS=Homo sapiens OX=9606 GN=DYSF PE=1 SV=1
8	Q69ZN7	0.0	2315	2048	0.564	0.573	MYOF_MOUSE Myoferlin OS=Mus musculus OX=10090 GN=Myof PE=1 SV=2
9	Q9ERC5	0.0	700	1993	0.197	0.206	OTOF_RAT Otoferlin OS=Rattus norvegicus OX=10116 GN=Otof PE=1 SV=2
10	Q9ESD7	0.0	3949	2090	0.938	0.933	DYSF_MOUSE Dysferlin OS=Mus musculus OX=10090 GN=Dysf PE=1 SV=3
11	Q9ESF1	0.0	697	1997	0.199	0.207	OTOF_MOUSE Otoferlin OS=Mus musculus OX=10090 GN=Otof PE=1 SV=1
12	Q9HC10	0.0	691	1997	0.199	0.207	OTOF_HUMAN Otoferlin OS=Homo sapiens OX=9606 GN=OTOF PE=1 SV=3
13	Q9NZM1	0.0	2304	2061	0.564	0.569	MYOF_HUMAN Myoferlin OS=Homo sapiens OX=9606 GN=MYOF PE=1 SV=1
14	Q5SPC5	1.76e-143	497	1992	0.131	0.137	OTOF_DANRE Otoferlin OS=Danio rerio OX=7955 GN=otof PE=3 SV=1
15	Q17388	3.40e-120	426	2034	0.187	0.191	FER1_CAEEL Sperm vesicle fusion protein fer-1 OS=Caenorhabditis elegans OX=6239 GN=fer-1 PE=2 SV=1
16	B2D6N9	2.68e-116	413	1907	0.183	0.199	B2D6N9_CAEEL C2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=fer-1 PE=3 SV=1
17	B7Z0E8	2.33e-90	311	648	0.099	0.318	B7Z0E8_DROME Misfire, isoform J OS=Drosophila melanogaster OX=7227 GN=mfr PE=4 SV=1
18	B7Z0E7	7.35e-86	313	1351	0.099	0.152	B7Z0E7_DROME Misfire, isoform D OS=Drosophila melanogaster OX=7227 GN=mfr PE=4 SV=1
19	B7Z0E6	1.09e-85	313	1439	0.099	0.143	B7Z0E6_DROME Misfire, isoform I OS=Drosophila melanogaster OX=7227 GN=mfr PE=4 SV=1
20	B7Z0E5	2.16e-85	313	1647	0.099	0.125	B7Z0E5_DROME Misfire, isoform F OS=Drosophila melanogaster OX=7227 GN=mfr PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	3.2e-96	327.8	C2 domain
2	PF17842 dsRBD2	1.6e+02	13.8	Double-stranded RNA binding domain 2
3	PF08165 FerA	5.9e-18	75.9	FerA (NUC095) domain
4	PF08150 FerB	6.6e-28	108.4	FerB (NUC096) domain
5	PF08151 FerI	6.6e-15	66.2	FerI (NUC094) domain
6	PF16165 Ferlin_C	3.2e-23	93.9	Ferlin C-terminus
7	PF06398 Pex24p	0.019	25.6	Integral peroxisomal membrane peroxin
8	PF00792 PI3K_C2	2.3e+02	13.1	Phosphoinositide 3-kinase C2
9	PF10409 PTEN_C2	20	16.4	C2 domain of PTEN tumour-suppressor protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008958524.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003814272.1	0.946	May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity
2	9597.XP_008957913.1	0.896	Tripartite motif-containing protein 72
3	9597.XP_003822241.1	0.876	Annexin A1
4	9597.XP_003827964.1	0.873	Annexin A2
5	9597.XP_003829044.1	0.806	Annexin A6 isoform X1
6	9597.XP_003815636.2	0.780	Tripartite motif containing 50
7	9597.XP_008961222.1	0.744	Emerin isoform X1
8	9597.XP_003820525.1	0.734	Annexin A13
9	9597.XP_008958526.1	0.733	Exocyst complex component 6B isoform X1
10	9597.XP_008971497.1	0.724	Belongs to the peptidase C2 family.
11	9597.XP_003809102.1	0.700	Annexin A8
12	9597.XP_003823254.1	0.690	Family with sequence similarity 65 member B
13	9597.XP_008969204.1	0.679	Dystrophin
14	9597.XP_008952139.1	0.675	Neuroblast differentiation-associated protein AHNAK
15	9597.XP_008952140.1	0.675	AHNAK nucleoprotein
16	9597.XP_008976326.1	0.656	Blood vessel epicardial substance
17	9597.XP_003819801.1	0.655	Monocyte to macrophage differentiation factor 2
18	9597.XP_008968918.1	0.653	Alpha-sarcoglycan isoform X1
19	9597.XP_008969097.1	0.647	Fukutin related protein
20	9597.XP_003823089.1	0.644	Voltage-dependent L-type calcium channel subunit alpha-1S

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005543	0.999	phospholipid binding
GO:0008092	0.996	cytoskeletal protein binding
GO:0046872	0.995	metal ion binding
GO:0015631	0.994	tubulin binding
GO:0005509	0.993	calcium ion binding
GO:0043014	0.977	alpha-tubulin binding
GO:0008017	0.976	microtubule binding
GO:0005544	0.813	calcium-dependent phospholipid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050789	0.967	regulation of biological process
GO:0032501	0.966	multicellular organismal process
GO:0050794	0.964	regulation of cellular process
GO:0050896	0.895	response to stimulus
GO:0071840	0.737	cellular component organization or biogenesis
GO:0016043	0.716	cellular component organization
GO:0051049	0.677	regulation of transport
GO:0032502	0.644	developmental process
GO:0048519	0.636	negative regulation of biological process
GO:0048856	0.611	anatomical structure development
GO:0002274	0.590	myeloid leukocyte activation
GO:0050764	0.539	regulation of phagocytosis
GO:0002252	0.490	immune effector process
GO:0002263	0.480	cell activation involved in immune response
GO:0008152	0.464	metabolic process
GO:0002366	0.433	leukocyte activation involved in immune response
GO:0051051	0.407	negative regulation of transport
GO:0071704	0.392	organic substance metabolic process
GO:0061024	0.369	membrane organization
GO:0010256	0.349	endomembrane system organization
GO:0044237	0.329	cellular metabolic process
GO:0044238	0.326	primary metabolic process
GO:0048518	0.300	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.998	intracellular anatomical structure
GO:0005737	0.988	cytoplasm
GO:0042383	0.971	sarcolemma
GO:0030315	0.953	T-tubule
GO:0043227	0.950	membrane-bounded organelle
GO:0043229	0.919	intracellular organelle
GO:0012505	0.910	endomembrane system
GO:0043231	0.806	intracellular membrane-bounded organelle
GO:0031982	0.591	vesicle
GO:0031410	0.471	cytoplasmic vesicle
GO:0043232	0.456	intracellular non-membrane-bounded organelle
GO:0031981	0.339	nuclear lumen
GO:0005654	0.309	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]