StarFunc result for job id O75925

User Input

>input (651 residues)
MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
YRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHEL
ELPHLTSALHPVHPDIKLQKLPFYDLLDELIKPTSLASDNSQRFRETCFAFALTPQQVQQ
ISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNYSMAVYLVKQLSSTVLLQRLRAK
GIRNPDHSRALIKEKLTADPDSEIATTSLRVSLLCPLGKMRLTIPCRALTCSHLQCFDAT
LYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILKYCTDCDEIQFKEDGTWAPMRSKK
EVQEVSASYNGVDGCLSSTLEHQVASHHQSSNKNKKVEVIDLTIDSSSDEEEEEPSAKRT
CPSLSPTSPLNNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQDYRHPFHMTPMPYDL
QGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTS
LPTTNGSSSGSNSSLVSSNSLRESHSHTVTNRSSTDTASIFGIIPDIISLD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G3V9T0	0.860	0.860	0.000	651	0.982	0.982	G3V9T0.pdb.gz	G3V9T0_RAT Protein inhibitor of activated STAT, 1 OS=Rattus norvegicus OX=10116 GN=Pias1 PE=1 SV=2
2	AFDB:A9UK05	0.568	0.568	3.249E-103	651	0.980	0.980	A9UK05.pdb.gz	A9UK05_RAT Protein inhibitor of activated STAT-1 OS=Rattus norvegicus OX=10116 GN=Pias1 PE=2 SV=1
3	AFDB:A1Z7P5	0.431	0.438	2.958E-54	640	0.350	0.356	A1Z7P5.pdb.gz	A1Z7P5_DROME Suppressor of variegation 2-10, isoform I OS=Drosophila melanogaster OX=7227 GN=Su(var)2-10 PE=1 SV=1
4	AFDB:O94451	0.402	0.365	7.449E-31	727	0.214	0.191	O94451.pdb.gz	PLI1_SCHPO E3 SUMO-protein ligase pli1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pli1 PE=1 SV=3
5	AFDB:A4VT01	0.083	0.079	1.546E-2	698	0.137	0.128	A4VT01.pdb.gz
6	AFDB:Q86XN8	0.072	0.072	8.252E-2	651	0.135	0.135	Q86XN8.pdb.gz	MEX3D_HUMAN RNA-binding protein MEX3D OS=Homo sapiens OX=9606 GN=MEX3D PE=1 SV=3
7	AFDB:A0A1D5NXF3	0.074	0.069	8.742E-2	732	0.132	0.117	A0A1D5NXF3.pdb.gz	A0A1D5NXF3_CHICK T-box 3 OS=Gallus gallus OX=9031 GN=TBX3 PE=4 SV=1
8	PDB:3j4qB	0.056	0.082	1.009E-1	382	0.054	0.092	3j4qB.pdb.gz
9	PDB:5jm0A	0.118	0.087	1.009E-1	940	0.023	0.016	5jm0A.pdb.gz
10	PDB:4r8pL	0.094	0.233	1.069E-1	254	0.034	0.087	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
11	AFDB:O15119	0.053	0.051	1.852E-1	743	0.143	0.125	O15119.pdb.gz	TBX3_HUMAN T-box transcription factor TBX3 OS=Homo sapiens OX=9606 GN=TBX3 PE=1 SV=4
12	PDB:4mexA	0.049	0.077	2.018E-1	298	0.046	0.101	4mexA.pdb.gz	Transcription inhibition by the depsipeptide antibiotic salinamide A.
13	PDB:4uybA	0.072	0.105	2.138E-1	401	0.015	0.025	4uybA.pdb.gz
14	PDB:6de7L	0.058	0.132	2.265E-1	208	0.028	0.087	6de7L.pdb.gz	Interdomain Stabilization Impairs CD4 Binding and Improves Immunogenicity of the HIV-1 Envelope Trimer.
15	PDB:1kfxL	0.076	0.077	2.399E-1	640	0.023	0.023	1kfxL.pdb.gz
16	PDB:4jk1A	0.050	0.074	2.399E-1	323	0.048	0.096	4jk1A.pdb.gz	Differential regulation by ppGpp versus pppGpp in Escherichia coli.
17	AFDB:Q7ZTU9	0.054	0.052	2.775E-1	687	0.149	0.141	Q7ZTU9.pdb.gz	TBX2_DANRE T-box transcription factor TBX2b OS=Danio rerio OX=7955 GN=tbx2b PE=1 SV=4
18	PDB:7y1rB	0.070	0.126	2.853E-1	308	0.017	0.036	7y1rB.pdb.gz
19	PDB:1js9C	0.090	0.199	3.023E-1	189	0.038	0.132	1js9C.pdb.gz
20	AFDB:A2RUW2	0.053	0.050	3.704E-1	689	0.127	0.120	A2RUW2.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5Y680	0.0	1132	577	0.842	0.950	A0A8I5Y680_RAT Protein inhibitor of activated STAT, 1 OS=Rattus norvegicus OX=10116 GN=Pias1 PE=3 SV=1
2	A0A8I6AIY4	0.0	1316	651	0.982	0.982	A0A8I6AIY4_RAT Protein inhibitor of activated STAT, 1 OS=Rattus norvegicus OX=10116 GN=Pias1 PE=3 SV=1
3	A0A8I6AJT7	0.0	1301	658	0.971	0.960	A0A8I6AJT7_RAT Protein inhibitor of activated STAT, 1 OS=Rattus norvegicus OX=10116 GN=Pias1 PE=3 SV=1
4	A9UK05	0.0	1314	651	0.980	0.980	A9UK05_RAT Protein inhibitor of activated STAT-1 OS=Rattus norvegicus OX=10116 GN=Pias1 PE=2 SV=1
5	G3V9T0	0.0	1129	624	0.900	0.939	G3V9T0_RAT Protein inhibitor of activated STAT, 1 OS=Rattus norvegicus OX=10116 GN=Pias1 PE=1 SV=2
6	O54714	0.0	684	628	0.585	0.607	PIAS3_MOUSE E3 SUMO-protein ligase PIAS3 OS=Mus musculus OX=10090 GN=Pias3 PE=1 SV=3
7	O70260	0.0	686	628	0.594	0.616	PIAS3_RAT E3 SUMO-protein ligase PIAS3 OS=Rattus norvegicus OX=10116 GN=Pias3 PE=1 SV=2
8	O75925	0.0	1339	651	1.000	1.000	PIAS1_HUMAN E3 SUMO-protein ligase PIAS1 OS=Homo sapiens OX=9606 GN=PIAS1 PE=1 SV=2
9	O75928	0.0	632	621	0.525	0.551	PIAS2_HUMAN E3 SUMO-protein ligase PIAS2 OS=Homo sapiens OX=9606 GN=PIAS2 PE=1 SV=3
10	O88907	0.0	1313	651	0.980	0.980	PIAS1_MOUSE E3 SUMO-protein ligase PIAS1 OS=Mus musculus OX=10090 GN=Pias1 PE=1 SV=2
11	Q5QGZ1	0.0	1109	564	0.819	0.945	Q5QGZ1_CHICK PIAS1 OS=Gallus gallus OX=9031 GN=PIAS1 PE=2 SV=1
12	Q6AZ28	0.0	620	572	0.513	0.584	PIAS2_RAT E3 SUMO-protein ligase PIAS2 OS=Rattus norvegicus OX=10116 GN=Pias2 PE=1 SV=1
13	Q6IAR4	0.0	675	619	0.581	0.611	Q6IAR4_HUMAN PIAS3 protein OS=Homo sapiens OX=9606 GN=PIAS3 PE=2 SV=1
14	Q8C5D8	0.0	627	621	0.522	0.548	PIAS2_MOUSE E3 SUMO-protein ligase PIAS2 OS=Mus musculus OX=10090 GN=Pias2 PE=1 SV=2
15	Q9Y6X2	0.0	685	628	0.588	0.610	PIAS3_HUMAN E3 SUMO-protein ligase PIAS3 OS=Homo sapiens OX=9606 GN=PIAS3 PE=1 SV=2
16	Q8N2W9	7.06e-142	425	510	0.336	0.429	PIAS4_HUMAN E3 SUMO-protein ligase PIAS4 OS=Homo sapiens OX=9606 GN=PIAS4 PE=1 SV=1
17	Q9JM05	3.18e-138	415	507	0.332	0.426	PIAS4_MOUSE E3 SUMO-protein ligase PIAS4 OS=Mus musculus OX=10090 GN=Pias4 PE=1 SV=2
18	A0A0B4LEH9	1.56e-126	387	577	0.313	0.354	A0A0B4LEH9_DROME Suppressor of variegation 2-10, isoform N OS=Drosophila melanogaster OX=7227 GN=Su(var)2-10 PE=1 SV=1
19	A1Z7P7	2.45e-126	387	569	0.313	0.359	A1Z7P7_DROME Suppressor of variegation 2-10, isoform H OS=Drosophila melanogaster OX=7227 GN=Su(var)2-10 PE=1 SV=1
20	A0A0B4JCQ7	2.85e-126	385	537	0.313	0.380	A0A0B4JCQ7_DROME Suppressor of variegation 2-10, isoform K OS=Drosophila melanogaster OX=7227 GN=Su(var)2-10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14324 PINIT	7.4e-32	122.1	PINIT domain
2	PF02891 zf-MIZ	4.3e-17	72.9	MIZ/SP-RING zinc finger
3	PF11789 zf-Nse	4.3	18.6	Zinc-finger of the MIZ type in Nse subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000015951

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000008183	0.995	Signal transducer and activator of transcription 1, 91kDa
2	61853.ENSNLEP00000008535	0.982	Small ubiquitin-like modifier 1
3	61853.ENSNLEP00000010420	0.979	Ubiquitin-conjugating enzyme E2I
4	61853.ENSNLEP00000022529	0.922	Small ubiquitin-related modifier
5	61853.ENSNLEP00000014018	0.906	Signal transducer and activator of transcription 3 (acute-phase response factor)
6	61853.ENSNLEP00000021239	0.905	Signal transducer and activator of transcription 2, 113kDa
7	61853.ENSNLEP00000024181	0.898	Signal transducer and activator of transcription 4
8	61853.ENSNLEP00000002882	0.886	Small ubiquitin-like modifier 3
9	61853.ENSNLEP00000000665	0.864	Uncharacterized protein
10	61853.ENSNLEP00000024197	0.828	Uncharacterized protein
11	61853.ENSNLEP00000001082	0.827	DNA-binding protein SATB
12	61853.ENSNLEP00000011861	0.826	Cellular tumor antigen p53
13	61853.ENSNLEP00000014631	0.822	Breast cancer type 1 susceptibility protein homolog
14	61853.ENSNLEP00000021135	0.792	Signal transducer and activator of transcription 6, interleukin-4 induced
15	61853.ENSNLEP00000014415	0.780	Mothers against decapentaplegic homolog
16	61853.ENSNLEP00000004551	0.774	MDM2 proto-oncogene, E3 ubiquitin protein ligase
17	61853.ENSNLEP00000000755	0.736	annotation not available
18	61853.ENSNLEP00000011064	0.724	Protein tyrosine phosphatase, non-receptor type 2
19	61853.ENSNLEP00000023868	0.717	Serine/arginine-rich splicing factor 1
20	61853.ENSNLEP00000002601	0.711	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019904	1.000	protein domain specific binding
GO:0019789	0.999	SUMO transferase activity
GO:0019899	0.621	enzyme binding
GO:0008134	0.617	transcription factor binding
GO:0140297	0.443	DNA-binding transcription factor binding
GO:0003676	0.333	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.990	cellular process
GO:0050896	0.989	response to stimulus
GO:0080090	0.989	regulation of primary metabolic process
GO:0051171	0.989	regulation of nitrogen compound metabolic process
GO:0060255	0.988	regulation of macromolecule metabolic process
GO:0031323	0.978	regulation of cellular metabolic process
GO:0048518	0.969	positive regulation of biological process
GO:0051246	0.966	regulation of protein metabolic process
GO:0010468	0.963	regulation of gene expression
GO:0010557	0.961	positive regulation of macromolecule biosynthetic process
GO:0019219	0.956	regulation of nucleobase-containing compound metabolic process
GO:0045935	0.947	positive regulation of nucleobase-containing compound metabolic process
GO:0048523	0.945	negative regulation of cellular process
GO:0032502	0.942	developmental process
GO:0006355	0.941	regulation of DNA-templated transcription
GO:0016043	0.937	cellular component organization
GO:0031399	0.937	regulation of protein modification process
GO:0044238	0.928	primary metabolic process
GO:0006807	0.928	nitrogen compound metabolic process
GO:1903320	0.928	regulation of protein modification by small protein conjugation or removal
GO:0051247	0.927	positive regulation of protein metabolic process
GO:0031328	0.926	positive regulation of cellular biosynthetic process
GO:0043170	0.925	macromolecule metabolic process
GO:0051254	0.924	positive regulation of RNA metabolic process
GO:0009314	0.913	response to radiation
GO:0045893	0.910	positive regulation of DNA-templated transcription
GO:0032501	0.892	multicellular organismal process
GO:0051716	0.859	cellular response to stimulus
GO:0031401	0.851	positive regulation of protein modification process
GO:1903322	0.828	positive regulation of protein modification by small protein conjugation or removal
GO:0009416	0.820	response to light stimulus
GO:0007612	0.807	learning
GO:0007632	0.801	visual behavior
GO:0050793	0.746	regulation of developmental process
GO:0045595	0.715	regulation of cell differentiation
GO:0022402	0.685	cell cycle process
GO:0008306	0.652	associative learning
GO:0010941	0.651	regulation of cell death
GO:0008542	0.643	visual learning
GO:1903047	0.601	mitotic cell cycle process
GO:0044770	0.600	cell cycle phase transition
GO:0042981	0.597	regulation of apoptotic process
GO:0051147	0.587	regulation of muscle cell differentiation
GO:0044237	0.558	cellular metabolic process
GO:0043933	0.545	protein-containing complex organization
GO:0051094	0.515	positive regulation of developmental process
GO:0000003	0.506	reproduction
GO:0045597	0.496	positive regulation of cell differentiation
GO:0032504	0.469	multicellular organism reproduction
GO:0007165	0.465	signal transduction
GO:0071824	0.454	protein-DNA complex subunit organization
GO:0044772	0.454	mitotic cell cycle phase transition
GO:0022414	0.452	reproductive process
GO:0019953	0.443	sexual reproduction
GO:0019538	0.437	protein metabolic process
GO:0036211	0.428	protein modification process
GO:0044085	0.421	cellular component biogenesis
GO:0006357	0.413	regulation of transcription by RNA polymerase II
GO:0044843	0.412	cell cycle G1/S phase transition
GO:0051149	0.411	positive regulation of muscle cell differentiation
GO:0009892	0.391	negative regulation of metabolic process
GO:0051172	0.378	negative regulation of nitrogen compound metabolic process
GO:0022607	0.368	cellular component assembly
GO:0060548	0.345	negative regulation of cell death
GO:0010605	0.343	negative regulation of macromolecule metabolic process
GO:0043066	0.342	negative regulation of apoptotic process
GO:0048609	0.316	multicellular organismal reproductive process
GO:0007283	0.313	spermatogenesis
GO:0048583	0.310	regulation of response to stimulus
GO:0070647	0.303	protein modification by small protein conjugation or removal

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0031981	0.989	nuclear lumen
GO:0005654	0.984	nucleoplasm
GO:0005829	0.510	cytosol
GO:0032991	0.390	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.999	Transferases.

[back to server]