StarFunc result for job id O75928

User Input

>input (621 residues)
MADFEELRNMVSSFRVSELQVLLGFAGRNKSGRKHDLLMRALHLLKSGCSPAVQIKIREL
YRRRYPRTLEGLSDLSTIKSSVFSLDGGSSPVEPDLAVAGIHSLPSTSVTPHSPSSPVGS
VLLQDTKPTFEMQQPSPPIPPVHPDVQLKNLPFYDVLDVLIKPTSLVQSSIQRFQEKFFI
FALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLAETSCPQEDNYPNSLCIKVNGKLFP
LPGYAPPPKNGIEQKRPGRPLNITSLVRLSSAVPNQISISWASEIGKNYSMSVYLVRQLT
SAMLLQRLKMKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLMCPLGKMRLTIPCRAV
TCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDCSDVDEIKFQE
DGSWCPMRPKKEAMKVSSQPCTKIESSSVLSKPCSVTVASEASKKKVDVIDLTIESSSDE
EEDPPAKRKCIFMSETQSSPTKGVLMYQPSSVRVPSVTSVDPAAIPPSLTDYSVPFHHTP
ISSMSSDLPGLDFLSLIPVDPQYCPPMFLDSLTSPLTASSTSVTTTSSHESSTHVSSSSS
RSETGVITSSGSNIPDIISLD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75928	1.000	1.000	0.000	621	1.000	1.000	O75928.pdb.gz	PIAS2_HUMAN E3 SUMO-protein ligase PIAS2 OS=Homo sapiens OX=9606 GN=PIAS2 PE=1 SV=3
2	AFDB:A9UK05	0.626	0.599	1.492E-69	651	0.593	0.565	A9UK05.pdb.gz	A9UK05_RAT Protein inhibitor of activated STAT-1 OS=Rattus norvegicus OX=10116 GN=Pias1 PE=2 SV=1
3	AFDB:O94451	0.391	0.340	2.660E-29	727	0.219	0.187	O94451.pdb.gz	PLI1_SCHPO E3 SUMO-protein ligase pli1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pli1 PE=1 SV=3
4	AFDB:Q12216	0.399	0.349	6.689E-27	726	0.177	0.152	Q12216.pdb.gz	SIZ2_YEAST E3 SUMO-protein ligase SIZ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NFI1 PE=1 SV=1
5	AFDB:Q16650	0.076	0.071	2.370E-3	682	0.116	0.106	Q16650.pdb.gz	TBR1_HUMAN T-box brain protein 1 OS=Homo sapiens OX=9606 GN=TBR1 PE=1 SV=1
6	AFDB:Q98TU2	0.079	0.076	2.991E-3	661	0.137	0.129	Q98TU2.pdb.gz	Q98TU2_DANRE Eomesa protein OS=Danio rerio OX=7955 GN=eomes PE=2 SV=1
7	PDB:4r8pL	0.098	0.232	1.990E-2	254	0.037	0.091	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
8	AFDB:A0A1D5NXF3	0.082	0.073	3.650E-2	732	0.124	0.105	A0A1D5NXF3.pdb.gz	A0A1D5NXF3_CHICK T-box 3 OS=Gallus gallus OX=9031 GN=TBX3 PE=4 SV=1
9	AFDB:M9NDZ1	0.072	0.061	5.813E-2	898	0.110	0.076	M9NDZ1.pdb.gz	M9NDZ1_DROME Serine-arginine protein kinase at 79D, isoform I OS=Drosophila melanogaster OX=7227 GN=Srpk79D PE=4 SV=1
10	AFDB:Q80XH2	0.057	0.037	8.736E-2	1243	0.143	0.072	Q80XH2.pdb.gz	IMPG2_MOUSE Interphotoreceptor matrix proteoglycan 2 OS=Mus musculus OX=10090 GN=Impg2 PE=1 SV=1
11	AFDB:Q9JIX8	0.057	0.029	8.736E-2	1338	0.161	0.075	Q9JIX8.pdb.gz	ACINU_MOUSE Apoptotic chromatin condensation inducer in the nucleus OS=Mus musculus OX=10090 GN=Acin1 PE=1 SV=3
12	PDB:7y1rB	0.124	0.207	1.208E-1	308	0.040	0.081	7y1rB.pdb.gz
13	PDB:4fixA	0.092	0.091	1.616E-1	629	0.042	0.041	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
14	PDB:7sqyB	0.121	0.319	1.924E-1	175	0.035	0.126	7sqyB.pdb.gz
15	PDB:5jm0A	0.126	0.086	2.162E-1	940	0.021	0.014	5jm0A.pdb.gz
16	PDB:5vqfB	0.118	0.195	2.162E-1	320	0.037	0.072	5vqfB.pdb.gz
17	PDB:3j4qB	0.064	0.090	2.429E-1	382	0.058	0.094	3j4qB.pdb.gz
18	PDB:5ffoG	0.116	0.205	2.574E-1	297	0.032	0.067	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
19	PDB:1kfxL	0.067	0.065	2.728E-1	640	0.019	0.019	1kfxL.pdb.gz
20	PDB:7drtB	0.089	0.108	2.728E-1	496	0.031	0.038	7drtB.pdb.gz	Cryo-EM structure of human Wntless in complex with Wnt3a.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5Y680	0.0	622	577	0.548	0.589	A0A8I5Y680_RAT Protein inhibitor of activated STAT, 1 OS=Rattus norvegicus OX=10116 GN=Pias1 PE=3 SV=1
2	A0A8I6AIY4	0.0	627	651	0.588	0.561	A0A8I6AIY4_RAT Protein inhibitor of activated STAT, 1 OS=Rattus norvegicus OX=10116 GN=Pias1 PE=3 SV=1
3	A0A8I6AJT7	0.0	618	658	0.580	0.547	A0A8I6AJT7_RAT Protein inhibitor of activated STAT, 1 OS=Rattus norvegicus OX=10116 GN=Pias1 PE=3 SV=1
4	A9UK05	0.0	627	651	0.588	0.561	A9UK05_RAT Protein inhibitor of activated STAT-1 OS=Rattus norvegicus OX=10116 GN=Pias1 PE=2 SV=1
5	G3V9T0	0.0	562	624	0.536	0.534	G3V9T0_RAT Protein inhibitor of activated STAT, 1 OS=Rattus norvegicus OX=10116 GN=Pias1 PE=1 SV=2
6	O54714	0.0	622	628	0.554	0.548	PIAS3_MOUSE E3 SUMO-protein ligase PIAS3 OS=Mus musculus OX=10090 GN=Pias3 PE=1 SV=3
7	O70260	0.0	625	628	0.588	0.581	PIAS3_RAT E3 SUMO-protein ligase PIAS3 OS=Rattus norvegicus OX=10116 GN=Pias3 PE=1 SV=2
8	O75925	0.0	629	651	0.591	0.564	PIAS1_HUMAN E3 SUMO-protein ligase PIAS1 OS=Homo sapiens OX=9606 GN=PIAS1 PE=1 SV=2
9	O75928	0.0	1260	621	1.000	1.000	PIAS2_HUMAN E3 SUMO-protein ligase PIAS2 OS=Homo sapiens OX=9606 GN=PIAS2 PE=1 SV=3
10	O88907	0.0	630	651	0.589	0.562	PIAS1_MOUSE E3 SUMO-protein ligase PIAS1 OS=Mus musculus OX=10090 GN=Pias1 PE=1 SV=2
11	Q5QGZ1	0.0	621	564	0.546	0.601	Q5QGZ1_CHICK PIAS1 OS=Gallus gallus OX=9031 GN=PIAS1 PE=2 SV=1
12	Q6AZ28	0.0	1111	572	0.866	0.941	PIAS2_RAT E3 SUMO-protein ligase PIAS2 OS=Rattus norvegicus OX=10116 GN=Pias2 PE=1 SV=1
13	Q6IAR4	0.0	611	619	0.551	0.553	Q6IAR4_HUMAN PIAS3 protein OS=Homo sapiens OX=9606 GN=PIAS3 PE=2 SV=1
14	Q8C5D8	0.0	1242	621	0.981	0.981	PIAS2_MOUSE E3 SUMO-protein ligase PIAS2 OS=Mus musculus OX=10090 GN=Pias2 PE=1 SV=2
15	Q9Y6X2	0.0	622	628	0.557	0.551	PIAS3_HUMAN E3 SUMO-protein ligase PIAS3 OS=Homo sapiens OX=9606 GN=PIAS3 PE=1 SV=2
16	Q9JM05	1.52e-135	407	507	0.353	0.432	PIAS4_MOUSE E3 SUMO-protein ligase PIAS4 OS=Mus musculus OX=10090 GN=Pias4 PE=1 SV=2
17	Q8N2W9	9.46e-133	400	510	0.354	0.431	PIAS4_HUMAN E3 SUMO-protein ligase PIAS4 OS=Homo sapiens OX=9606 GN=PIAS4 PE=1 SV=1
18	A0A0B4LEH9	8.91e-117	361	577	0.314	0.338	A0A0B4LEH9_DROME Suppressor of variegation 2-10, isoform N OS=Drosophila melanogaster OX=7227 GN=Su(var)2-10 PE=1 SV=1
19	A1Z7P7	1.34e-116	360	569	0.314	0.343	A1Z7P7_DROME Suppressor of variegation 2-10, isoform H OS=Drosophila melanogaster OX=7227 GN=Su(var)2-10 PE=1 SV=1
20	A0A0B4JD33	2.03e-116	361	584	0.314	0.334	A0A0B4JD33_DROME Suppressor of variegation 2-10, isoform L OS=Drosophila melanogaster OX=7227 GN=Su(var)2-10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00628 PHD	7.4e+02	11.5	PHD-finger
2	PF14324 PINIT	4.3e-28	109.9	PINIT domain
3	PF02891 zf-MIZ	2.1e-18	77.1	MIZ/SP-RING zinc finger
4	PF11789 zf-Nse	3.3	19.0	Zinc-finger of the MIZ type in Nse subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000465676

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348056	0.999	SUMO-conjugating enzyme UBC9
2	9606.ENSP00000376077	0.999	Small ubiquitin-related modifier 1
3	9606.ENSP00000405965	0.998	Small ubiquitin-related modifier 2
4	9606.ENSP00000363822	0.989	Androgen receptor
5	9606.ENSP00000409666	0.984	Small ubiquitin-like modifier 3
6	9606.ENSP00000418770	0.980	Protein/nucleic acid deglycase DJ-1
7	9606.ENSP00000314080	0.954	Hypermethylated in cancer 1 protein
8	9606.ENSP00000376134	0.950	Signal transducer and activator of transcription 4
9	9606.ENSP00000258149	0.922	E3 ubiquitin-protein ligase Mdm2
10	9606.ENSP00000287820	0.919	Peroxisome proliferator-activated receptor gamma
11	9606.ENSP00000356331	0.904	Nuclear receptor subfamily 5 group A member 2
12	9606.ENSP00000261523	0.903	Nuclear receptor ROR-alpha
13	9606.ENSP00000264637	0.903	Thyroid hormone receptor alpha
14	9606.ENSP00000316578	0.903	Polycomb protein SUZ12
15	9606.ENSP00000421491	0.903	DNA repair protein XRCC4
16	9606.ENSP00000354394	0.890	Signal transducer and activator of transcription 1-alpha/beta
17	9606.ENSP00000269305	0.882	Cellular tumor antigen p53
18	9606.ENSP00000287437	0.878	E3 SUMO-protein ligase NSE2
19	9606.ENSP00000479618	0.870	Myc proto-oncogene protein
20	9606.ENSP00000246548	0.847	SUMO-activating enzyme subunit 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0061629	1.000	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0019789	1.000	SUMO transferase activity
GO:0061665	0.976	SUMO ligase activity
GO:0043167	0.928	ion binding
GO:0046872	0.915	metal ion binding
GO:0008270	0.906	zinc ion binding
GO:0019899	0.691	enzyme binding
GO:1901363	0.510	heterocyclic compound binding
GO:0097159	0.510	organic cyclic compound binding
GO:0019904	0.510	protein domain specific binding
GO:0003676	0.492	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0071704	0.992	organic substance metabolic process
GO:0044238	0.992	primary metabolic process
GO:0060255	0.990	regulation of macromolecule metabolic process
GO:0051171	0.990	regulation of nitrogen compound metabolic process
GO:0009987	0.989	cellular process
GO:0080090	0.979	regulation of primary metabolic process
GO:0031323	0.977	regulation of cellular metabolic process
GO:0006807	0.976	nitrogen compound metabolic process
GO:0048518	0.970	positive regulation of biological process
GO:0043170	0.963	macromolecule metabolic process
GO:0050896	0.958	response to stimulus
GO:0019219	0.948	regulation of nucleobase-containing compound metabolic process
GO:0016925	0.948	protein sumoylation
GO:0010468	0.943	regulation of gene expression
GO:0031326	0.932	regulation of cellular biosynthetic process
GO:0010556	0.925	regulation of macromolecule biosynthetic process
GO:2001141	0.922	regulation of RNA biosynthetic process
GO:0048519	0.906	negative regulation of biological process
GO:1903506	0.905	regulation of nucleic acid-templated transcription
GO:0006355	0.904	regulation of DNA-templated transcription
GO:0048583	0.869	regulation of response to stimulus
GO:0044237	0.863	cellular metabolic process
GO:0048523	0.851	negative regulation of cellular process
GO:0048522	0.820	positive regulation of cellular process
GO:0051716	0.723	cellular response to stimulus
GO:0010604	0.719	positive regulation of macromolecule metabolic process
GO:0051173	0.547	positive regulation of nitrogen compound metabolic process
GO:0009966	0.541	regulation of signal transduction
GO:0031325	0.519	positive regulation of cellular metabolic process
GO:0006357	0.428	regulation of transcription by RNA polymerase II
GO:0007154	0.424	cell communication
GO:0034641	0.419	cellular nitrogen compound metabolic process
GO:0023052	0.394	signaling
GO:0009892	0.391	negative regulation of metabolic process
GO:0032502	0.385	developmental process
GO:0010605	0.384	negative regulation of macromolecule metabolic process
GO:0051172	0.370	negative regulation of nitrogen compound metabolic process
GO:0071840	0.365	cellular component organization or biogenesis
GO:0065009	0.365	regulation of molecular function
GO:0032501	0.349	multicellular organismal process
GO:0045935	0.340	positive regulation of nucleobase-containing compound metabolic process
GO:0006950	0.335	response to stress
GO:0016043	0.331	cellular component organization
GO:0031328	0.328	positive regulation of cellular biosynthetic process
GO:0007165	0.322	signal transduction
GO:0010557	0.321	positive regulation of macromolecule biosynthetic process
GO:1901360	0.319	organic cyclic compound metabolic process
GO:0042221	0.315	response to chemical
GO:0006725	0.315	cellular aromatic compound metabolic process
GO:0006139	0.313	nucleobase-containing compound metabolic process
GO:0051247	0.313	positive regulation of protein metabolic process
GO:0045893	0.304	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.782	cytoplasm
GO:0016604	0.619	nuclear body
GO:0043232	0.522	intracellular non-membrane-bounded organelle
GO:0005829	0.507	cytosol
GO:0032991	0.453	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]