StarFunc result for job id O75936

User Input

>input (387 residues)
MACTIQKAEALDGAHLMQILWYDEEESLYPAVWLRDNCPCSDCYLDSAKARKLLVEALDV
NIGIKGLIFDRKKVYITWPDEHYSEFQADWLKKRCFSKQARAKLQRELFFPECQYWGSEL
QLPTLDFEDVLRYDEHAYKWLSTLKKVGIVRLTGASDKPGEVSKLGKRMGFLYLTFYGHT
WQVQDKIDANNVAYTTGKLSFHTDYPALHHPPGVQLLHCIKQTVTGGDSEIVDGFNVCQK
LKKNNPQAFQILSSTFVDFTDIGVDYCDFSVQSKHKIIELDDKGQVVRINFNNATRDTIF
DVPVERVQPFYAALKEFVDLMNSKESKFTFKMNPGDVITFDNWRLLHGRRSYEAGTEISR
HLEGAYADWDVVMSRLRILRQRVENGN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75936	1.000	1.000	8.734E-86	387	1.000	1.000	O75936.pdb.gz	BODG_HUMAN Gamma-butyrobetaine dioxygenase OS=Homo sapiens OX=9606 GN=BBOX1 PE=1 SV=1
2	PDB:3o2gA	0.979	0.981	6.618E-79	386	0.987	0.990	3o2gA.pdb.gz	Structural and mechanistic studies on gamma-butyrobetaine hydroxylase.
3	AFDB:Q924Y0	0.994	0.994	1.478E-77	387	0.891	0.891	Q924Y0.pdb.gz	BODG_MOUSE Gamma-butyrobetaine dioxygenase OS=Mus musculus OX=10090 GN=Bbox1 PE=1 SV=1
4	AFDB:Q9NVH6	0.787	0.730	5.537E-37	421	0.258	0.238	Q9NVH6.pdb.gz	TMLH_HUMAN Trimethyllysine dioxygenase, mitochondrial OS=Homo sapiens OX=9606 GN=TMLHE PE=1 SV=1
5	AFDB:Q91ZE0	0.794	0.736	5.876E-37	421	0.271	0.249	Q91ZE0.pdb.gz	TMLH_MOUSE Trimethyllysine dioxygenase, mitochondrial OS=Mus musculus OX=10090 GN=Tmlhe PE=1 SV=2
6	AFDB:A0A1D8PNJ2	0.862	0.844	7.916E-37	396	0.276	0.270	A0A1D8PNJ2.pdb.gz	A0A1D8PNJ2_CANAL trimethyllysine dioxygenase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C502920WA PE=3 SV=1
7	AFDB:A0A1D8PRK5	0.847	0.808	7.329E-35	407	0.225	0.214	A0A1D8PRK5.pdb.gz	A0A1D8PRK5_CANAL TauD/TfdA-like domain-containing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C704310CA PE=3 SV=1
8	AFDB:P23180	0.812	0.686	5.275E-28	465	0.207	0.172	P23180.pdb.gz	AIM17_YEAST Probable oxidoreductase AIM17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AIM17 PE=1 SV=2
9	AFDB:E3VWI8	0.504	0.636	1.667E-12	299	0.106	0.137	E3VWI8.pdb.gz	PNTD_STRAE Pentalenolactone F synthase OS=Streptomyces arenae OX=29301 GN=pntD PE=3 SV=1
10	AFDB:E3VWK4	0.481	0.608	1.057E-11	298	0.109	0.141	E3VWK4.pdb.gz	PEND_STREX Pentalenolactone F synthase OS=Streptomyces exfoliatus OX=1905 GN=penD PE=3 SV=1
11	AFDB:P76621	0.471	0.550	1.702E-11	325	0.093	0.111	P76621.pdb.gz	GLAH_ECOLI Glutarate 2-hydroxylase OS=Escherichia coli (strain K12) OX=83333 GN=glaH PE=1 SV=2
12	PDB:1jr7A	0.456	0.561	7.057E-11	306	0.093	0.118	1jr7A.pdb.gz	Structural genomics: a pipeline for providing structures for the biologist.
13	PDB:6edhA	0.493	0.656	1.625E-10	281	0.121	0.167	6edhA.pdb.gz	Structure of a Ferryl Mimic in the Archetypal Iron(II)- and 2-(Oxo)-glutarate-Dependent Dioxygenase, TauD.
14	PDB:2q4aB	0.426	0.501	2.618E-10	322	0.129	0.155	2q4aB.pdb.gz	Ensemble refinement of protein crystal structures: validation and application.
15	PDB:6f2eA	0.481	0.558	9.709E-10	329	0.088	0.103	6f2eA.pdb.gz
16	PDB:4ffaA	0.395	0.597	1.161E-9	242	0.088	0.140	4ffaA.pdb.gz
17	PDB:3v17A	0.481	0.645	6.156E-9	276	0.103	0.145	3v17A.pdb.gz	The Fe(II) / alpha-ketoglutarate dependent taurine dioxygenases from Pseudomonas putida and Escherichia coli are tetramers
18	PDB:6almA	0.451	0.507	1.597E-8	338	0.111	0.127	6almA.pdb.gz	Visualizing the Reaction Cycle in an Iron(II)- and 2-(Oxo)-glutarate-Dependent Hydroxylase.
19	PDB:6mp8A	0.441	0.540	4.143E-8	308	0.106	0.133	6mp8A.pdb.gz	alpha-Amine Desaturation of d-Arginine by the Iron(II)- and 2-(Oxo)glutarate-Dependent l-Arginine 3-Hydroxylase, VioC.
20	PDB:6euoC	0.407	0.442	7.980E-8	354	0.096	0.105	6euoC.pdb.gz	Structural Studies based on two Lysine Dioxygenases with Distinct Regioselectivity Brings Insights Into Enzyme Specificity within the Clavaminate Synthase-Like Family.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75936	0.0	811	387	1.000	1.000	BODG_HUMAN Gamma-butyrobetaine dioxygenase OS=Homo sapiens OX=9606 GN=BBOX1 PE=1 SV=1
2	Q924Y0	0.0	731	387	0.891	0.891	BODG_MOUSE Gamma-butyrobetaine dioxygenase OS=Mus musculus OX=10090 GN=Bbox1 PE=1 SV=1
3	Q9QZU7	0.0	721	387	0.884	0.884	BODG_RAT Gamma-butyrobetaine dioxygenase OS=Rattus norvegicus OX=10116 GN=Bbox1 PE=1 SV=1
4	Q91ZW6	1.46e-50	177	421	0.276	0.254	TMLH_RAT Trimethyllysine dioxygenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Tmlhe PE=1 SV=2
5	Q91ZE0	2.14e-49	174	421	0.269	0.247	TMLH_MOUSE Trimethyllysine dioxygenase, mitochondrial OS=Mus musculus OX=10090 GN=Tmlhe PE=1 SV=2
6	A0A1D8PNJ2	1.38e-47	168	396	0.279	0.273	A0A1D8PNJ2_CANAL trimethyllysine dioxygenase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C502920WA PE=3 SV=1
7	Q9NVH6	6.86e-47	167	421	0.261	0.240	TMLH_HUMAN Trimethyllysine dioxygenase, mitochondrial OS=Homo sapiens OX=9606 GN=TMLHE PE=1 SV=1
8	A0A1D8PRK5	6.75e-26	110	407	0.245	0.233	A0A1D8PRK5_CANAL TauD/TfdA-like domain-containing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C704310CA PE=3 SV=1
9	P23180	4.77e-07	53.9	465	0.209	0.174	AIM17_YEAST Probable oxidoreductase AIM17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AIM17 PE=1 SV=2
10	C7Q942	0.18	36.2	343	0.059	0.067	ORR3O_CATAD L-ornithine/L-arginine 3-hydroxylase OS=Catenulispora acidiphila (strain DSM 44928 / JCM 14897 / NBRC 102108 / NRRL B-24433 / ID139908) OX=479433 GN=Caci_3456 PE=1 SV=1
11	O64835	0.51	33.9	167	0.044	0.102	O64835_ARATH At2g23670/F26B6.32 OS=Arabidopsis thaliana OX=3702 GN=YCF37 PE=1 SV=1
12	Q43714	1.2	33.9	555	0.049	0.034	DCS3_GOSAR (+)-delta-cadinene synthase isozyme A OS=Gossypium arboreum OX=29729 GN=CAD1-A PE=2 SV=1
13	Q556J8	1.4	33.5	1108	0.067	0.023	AP3B_DICDI AP-3 complex subunit beta OS=Dictyostelium discoideum OX=44689 GN=ap3b-1 PE=3 SV=1
14	O42854	1.9	33.1	1611	0.047	0.011	YFHH_SCHPO SH3 domain-containing protein C23A1.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23A1.17 PE=1 SV=1
15	Q9C0W2	4.0	32.3	1201	0.080	0.026	ATD22_SCHPO ATPase with bromodomain protein abo2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=abo2 PE=3 SV=1
16	O94653	6.5	31.6	1121	0.049	0.017	BMS1_SCHPO Ribosome biogenesis protein bms1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bms1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08943 CsiD	2.1	19.1	CsiD
2	PF06155 GBBH-like_N	1.1e-11	56.5	Gamma-butyrobetaine hydroxylase-like, N-terminal
3	PF18578 Raf1_N	52	15.8	Rubisco accumulation factor 1 alpha helical domain
4	PF02668 TauD	1.6e-40	151.2	Taurine catabolism dioxygenase TauD, TfdA family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263182

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000346827	0.950	4-trimethylaminobutyraldehyde dehydrogenase
2	9606.ENSP00000295756	0.937	T-cell receptor-associated transmembrane adapter 1
3	9606.ENSP00000261733	0.924	Aldehyde dehydrogenase, mitochondrial
4	9606.ENSP00000366927	0.922	Aldehyde dehydrogenase X, mitochondrial
5	9606.ENSP00000345774	0.916	Fatty aldehyde dehydrogenase
6	9606.ENSP00000348510	0.915	General transcription factor 3C polypeptide 1
7	9606.ENSP00000387123	0.909	Alpha-aminoadipic semialdehyde dehydrogenase
8	9606.ENSP00000355658	0.870	E3 ubiquitin-protein ligase TRIM17
9	9606.ENSP00000369373	0.837	Tripartite motif-containing protein 5
10	9606.ENSP00000410833	0.814	1,4-alpha-glucan-branching enzyme
11	9606.ENSP00000319974	0.803	HMG box transcription factor BBX
12	9606.ENSP00000254436	0.792	E3 ubiquitin-protein ligase TRIM21
13	9606.ENSP00000362298	0.789	Sphingosine-1-phosphate lyase 1
14	9606.ENSP00000312675	0.782	Tripartite motif-containing protein 72
15	9606.ENSP00000323913	0.764	Tripartite motif-containing protein 55
16	9606.ENSP00000298355	0.748	E3 ubiquitin-protein ligase TRIM9
17	9606.ENSP00000365844	0.745	E3 ubiquitin-protein ligase TRIM39
18	9606.ENSP00000485378	0.745	Ribonuclease P protein subunit p21
19	9606.ENSP00000296098	0.739	Tripartite motif containing 54
20	9606.ENSP00000452746	0.739	Proline-serine-threonine phosphatase-interacting protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008336	1.000	gamma-butyrobetaine dioxygenase activity
GO:0005515	0.996	protein binding
GO:0042802	0.993	identical protein binding
GO:0008270	0.967	zinc ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0071704	0.998	organic substance metabolic process
GO:0006807	0.978	nitrogen compound metabolic process
GO:0044237	0.959	cellular metabolic process
GO:1901564	0.934	organonitrogen compound metabolic process
GO:0034641	0.905	cellular nitrogen compound metabolic process
GO:0044271	0.837	cellular nitrogen compound biosynthetic process
GO:1901576	0.836	organic substance biosynthetic process
GO:1901566	0.832	organonitrogen compound biosynthetic process
GO:0042398	0.751	cellular modified amino acid biosynthetic process
GO:0006577	0.750	amino-acid betaine metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005737	1.000	cytoplasm
GO:0043231	0.993	intracellular membrane-bounded organelle
GO:0005829	0.971	cytosol
GO:0005576	0.867	extracellular region
GO:0031982	0.817	vesicle
GO:0070013	0.769	intracellular organelle lumen
GO:0005634	0.740	nucleus
GO:0070062	0.720	extracellular exosome
GO:0005739	0.712	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:24028	1.000	2-oxoglutarate + 4-(trimethylamino)butanoate + O2 = carnitine + CO2 + succinate
EC:1.14.11.1	1.000	gamma-butyrobetaine dioxygenase.

[back to server]