StarFunc result for job id O75937

User Input

>input (253 residues)
MAASGESGTSGGGGSTEEAFMTFYSEVKQIEKRDSVLTSKNQIERLTRPGSSYFNLNPFE
VLQIDPEVTDEEIKKRFRQLSILVHPDKNQDDADRAQKAFEAVDKAYKLLLDQEQKKRAL
DVIQAGKEYVEHTVKERKKQLKKEGKPTIVEEDDPELFKQAVYKQTMKLFAELEIKRKER
EAKEMHERKRQREEEIEAQEKAKREREWQKNFEESRDGRVDSWRNFQANTKGKKEKKNRT
FLRPPKVKMEQRE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75937	1.000	1.000	4.096E-32	253	1.000	1.000	O75937.pdb.gz	DNJC8_HUMAN DnaJ homolog subfamily C member 8 OS=Homo sapiens OX=9606 GN=DNAJC8 PE=1 SV=2
2	AFDB:O74746	0.615	0.733	1.321E-7	209	0.213	0.258	O74746.pdb.gz	SPF31_SCHPO J domain-containing protein spf31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spf31 PE=4 SV=1
3	AFDB:Q380Y9	0.258	0.227	3.905E-3	308	0.166	0.136	Q380Y9.pdb.gz	Q380Y9_TRYB2 Chaperone protein DNAJ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.8750 PE=4 SV=1
4	AFDB:D3ZSC8	0.295	0.251	4.568E-3	303	0.170	0.142	D3ZSC8.pdb.gz	DJC17_RAT DnaJ homolog subfamily C member 17 OS=Rattus norvegicus OX=10116 GN=Dnajc17 PE=3 SV=1
5	AFDB:Q9NVM6	0.293	0.247	4.568E-3	304	0.158	0.132	Q9NVM6.pdb.gz	DJC17_HUMAN DnaJ homolog subfamily C member 17 OS=Homo sapiens OX=9606 GN=DNAJC17 PE=1 SV=1
6	AFDB:Q9P7C6	0.259	0.232	1.000E-2	289	0.154	0.135	Q9P7C6.pdb.gz	CWC23_SCHPO Pre-mRNA-splicing factor cwf23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cwf23 PE=1 SV=2
7	AFDB:E5QCE7	0.239	0.277	1.601E-2	217	0.083	0.097	E5QCE7.pdb.gz	E5QCE7_CAEEL J domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dnj-14 PE=1 SV=1
8	AFDB:A0A0J9YX62	0.237	0.181	2.997E-2	334	0.091	0.069	A0A0J9YX62.pdb.gz	A0A0J9YX62_HUMAN DnaJ heat shock protein family (Hsp40) member B6 OS=Homo sapiens OX=9606 GN=DNAJB6 PE=1 SV=1
9	AFDB:Q9VGR0	0.318	0.273	2.997E-2	299	0.138	0.117	Q9VGR0.pdb.gz	Q9VGR0_DROME RE47242p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG17187 PE=1 SV=2
10	AFDB:Q7KQK3	0.241	0.249	3.327E-2	244	0.079	0.082	Q7KQK3.pdb.gz	Q7KQK3_PLAF7 Heat shock protein DNAJ homologue Pfj4 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1211400 PE=4 SV=1
11	PDB:1fpoA	0.214	0.310	2.713E-1	171	0.103	0.152	1fpoA.pdb.gz
12	PDB:7x3kA	0.219	0.211	3.344E-1	262	0.055	0.053	7x3kA.pdb.gz
13	PDB:3c98B	0.127	0.136	3.163	230	0.087	0.096	3c98B.pdb.gz
14	PDB:1gvhA	0.155	0.110	3.333	396	0.063	0.040	1gvhA.pdb.gz	The X-Ray Structure of Ferric Escherichia Coli Flavohemoglobin Reveals an Unexpected Geometry of the Distal Heme Pocket
15	PDB:3axjA	0.135	0.147	3.333	225	0.079	0.089	3axjA.pdb.gz
16	PDB:7q83D	0.151	0.230	3.333	156	0.119	0.192	7q83D.pdb.gz
17	PDB:3rqgC	0.163	0.181	3.511	212	0.119	0.142	3rqgC.pdb.gz	Molecular Recognition of Leucine-Aspartate Repeat (LD) Motifs by the Focal Adhesion Targeting Homology Domain of Cerebral Cavernous Malformation 3 (CCM3).
18	PDB:7ncdE	0.122	0.126	3.898	241	0.051	0.054	7ncdE.pdb.gz
19	PDB:6s7tA	0.166	0.071	4.804	706	0.055	0.020	6s7tA.pdb.gz	Cryo-electron microscopy structures of human oligosaccharyltransferase complexes OST-A and OST-B.
20	PDB:7dgqB4	0.129	0.241	4.804	109	0.083	0.193	7dgqB4.pdb.gz	A Dynamic Substrate Pool Revealed by cryo-EM of a Lipid-Preserved Respiratory Supercomplex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75937	0.0	511	253	1.000	1.000	DNJC8_HUMAN DnaJ homolog subfamily C member 8 OS=Homo sapiens OX=9606 GN=DNAJC8 PE=1 SV=2
2	O74746	7.10e-12	65.1	209	0.217	0.263	SPF31_SCHPO J domain-containing protein spf31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spf31 PE=4 SV=1
3	H0YHG0	8.14e-10	60.8	523	0.115	0.055	H0YHG0_HUMAN DnaJ homolog subfamily C member 14 (Fragment) OS=Homo sapiens OX=9606 PE=1 SV=1
4	Q95J56	1.02e-09	60.8	699	0.115	0.041	DJC14_BOVIN DnaJ homolog subfamily C member 14 OS=Bos taurus OX=9913 GN=DNAJC14 PE=1 SV=1
5	Q6Y2X3	1.31e-09	60.5	702	0.115	0.041	DJC14_HUMAN DnaJ homolog subfamily C member 14 OS=Homo sapiens OX=9606 GN=DNAJC14 PE=2 SV=2
6	Q5XIX0	1.62e-09	60.1	703	0.103	0.037	DJC14_RAT DnaJ homolog subfamily C member 14 OS=Rattus norvegicus OX=10116 GN=Dnajc14 PE=1 SV=1
7	Q0WT48	1.43e-08	57.4	687	0.119	0.044	DNJ21_ARATH DnaJ protein ERDJ2A OS=Arabidopsis thaliana OX=3702 GN=ERDJ2A PE=1 SV=1
8	A6PVC9	1.80e-08	54.7	161	0.111	0.174	A6PVC9_HUMAN SEC63 homolog, protein translocation regulator (Fragment) OS=Homo sapiens OX=9606 GN=SEC63 PE=1 SV=1
9	Q8NHS0	2.12e-08	55.5	232	0.111	0.121	DNJB8_HUMAN DnaJ homolog subfamily B member 8 OS=Homo sapiens OX=9606 GN=DNAJB8 PE=1 SV=1
10	A0A0S2Z5M1	1.40e-07	54.3	760	0.111	0.037	A0A0S2Z5M1_HUMAN SEC63-like (S. cerevisiae) (Fragment) OS=Homo sapiens OX=9606 GN=SEC63 PE=2 SV=1
11	Q9UGP8	1.40e-07	54.3	760	0.111	0.037	SEC63_HUMAN Translocation protein SEC63 homolog OS=Homo sapiens OX=9606 GN=SEC63 PE=1 SV=2
12	Q8VHE0	1.52e-07	54.3	760	0.115	0.038	SEC63_MOUSE Translocation protein SEC63 homolog OS=Mus musculus OX=10090 GN=Sec63 PE=1 SV=4
13	P48353	1.83e-07	52.8	224	0.091	0.103	HLJ1_YEAST Protein HLJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HLJ1 PE=1 SV=1
14	Q10MW6	1.94e-07	53.9	582	0.099	0.043	DJC27_ORYSJ DnaJ protein ERDJ3A OS=Oryza sativa subsp. japonica OX=39947 GN=ERDJ3A PE=1 SV=2
15	P39101	2.67e-07	53.1	391	0.103	0.066	CAJ1_YEAST Protein CAJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CAJ1 PE=1 SV=1
16	F4JIN3	4.01e-07	52.8	661	0.111	0.042	DNJ29_ARATH DnaJ protein ERDJ2B OS=Arabidopsis thaliana OX=3702 GN=ERDJ2B PE=1 SV=1
17	Q80ZP0	9.05e-07	50.8	234	0.091	0.098	Q80ZP0_MOUSE 4930503B20Rik protein OS=Mus musculus OX=10090 GN=4930503B20Rik PE=2 SV=1
18	G5E8V6	9.28e-07	50.8	231	0.091	0.100	G5E8V6_MOUSE RIKEN cDNA 4930503B20 gene OS=Mus musculus OX=10090 GN=4930503B20Rik PE=4 SV=1
19	Q17438	9.72e-07	51.2	401	0.123	0.077	DNJ1_CAEEL DnaJ homolog subfamily B member 1 OS=Caenorhabditis elegans OX=6239 GN=dnj-1 PE=1 SV=1
20	Q9ZSY2	1.05e-06	51.2	410	0.091	0.056	DNJ15_ARATH Chaperone protein dnaJ 15 OS=Arabidopsis thaliana OX=3702 GN=ATJ15 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00226 DnaJ	3.4e-13	60.8	DnaJ domain
2	PF11288 DUF3089	2.4e+02	12.6	Protein of unknown function (DUF3089)
3	PF13446 RPT	2.4e+02	13.1	A repeated domain in UCH-protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000011905

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000018780	0.911	Survival motor neuron domain containing 1
2	61853.ENSNLEP00000023868	0.857	Serine/arginine-rich splicing factor 1
3	61853.ENSNLEP00000006018	0.795	U2 snRNP-associated SURP domain containing
4	61853.ENSNLEP00000002587	0.784	Uncharacterized protein
5	61853.ENSNLEP00000011860	0.781	TNF receptor-associated protein 1
6	61853.ENSNLEP00000019000	0.727	Serine/arginine-rich splicing factor 9
7	61853.ENSNLEP00000011177	0.698	DnaJ (Hsp40) homolog, subfamily C, member 18
8	61853.ENSNLEP00000014735	0.651	Belongs to the heat shock protein 70 family.
9	61853.ENSNLEP00000002163	0.646	DnaJ (Hsp40) homolog, subfamily C, member 15
10	61853.ENSNLEP00000017591	0.638	DnaJ (Hsp40) homolog, subfamily C, member 21
11	61853.ENSNLEP00000010358	0.635	DnaJ (Hsp40) homolog, subfamily A, member 4
12	61853.ENSNLEP00000002034	0.629	Laminin, beta 3
13	61853.ENSNLEP00000012417	0.627	DnaJ (Hsp40) homolog, subfamily C, member 5
14	61853.ENSNLEP00000020187	0.622	DnaJ (Hsp40) homolog, subfamily C, member 3
15	61853.ENSNLEP00000014095	0.613	Uncharacterized protein
16	61853.ENSNLEP00000019927	0.613	Uncharacterized protein
17	61853.ENSNLEP00000017691	0.611	P21 protein (Cdc42/Rac)-activated kinase 4
18	61853.ENSNLEP00000019075	0.609	DnaJ (Hsp40) homolog, subfamily A, member 2
19	61853.ENSNLEP00000022001	0.593	Adenosine receptor A1
20	61853.ENSNLEP00000005754	0.561	DnaJ (Hsp40) homolog, subfamily B, member 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030544	1.000	Hsp70 protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0065007	0.992	biological regulation
GO:0044237	0.977	cellular metabolic process
GO:0050794	0.966	regulation of cellular process
GO:0071704	0.890	organic substance metabolic process
GO:0044238	0.853	primary metabolic process
GO:0006807	0.808	nitrogen compound metabolic process
GO:0071840	0.805	cellular component organization or biogenesis
GO:0043170	0.775	macromolecule metabolic process
GO:0016043	0.633	cellular component organization
GO:0019222	0.623	regulation of metabolic process
GO:1901360	0.584	organic cyclic compound metabolic process
GO:0046483	0.584	heterocycle metabolic process
GO:0006725	0.583	cellular aromatic compound metabolic process
GO:0034641	0.575	cellular nitrogen compound metabolic process
GO:0006139	0.526	nucleobase-containing compound metabolic process
GO:0060255	0.499	regulation of macromolecule metabolic process
GO:0090304	0.464	nucleic acid metabolic process
GO:0048519	0.459	negative regulation of biological process
GO:0048518	0.396	positive regulation of biological process
GO:0031323	0.393	regulation of cellular metabolic process
GO:0080090	0.375	regulation of primary metabolic process
GO:0051171	0.374	regulation of nitrogen compound metabolic process
GO:0050896	0.339	response to stimulus
GO:0048523	0.309	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0045171	0.757	intercellular bridge
GO:0032991	0.727	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]