StarFunc result for job id O75943

User Input

>input (681 residues)
MSKTFLRPKVSSTKVTDWVDPSFDDFLECSGVSTITATSLGVNNSSHRRKNGPSTLESSR
FPARKRGNLSSLEQIYGLENSKEYLSENEPWVDKYKPETQHELAVHKKKIEEVETWLKAQ
VLERQPKQGGSILLITGPPGCGKTTTLKILSKEHGIQVQEWINPVLPDFQKDDFKGMFNT
ESSFHMFPYQSQIAVFKEFLLRATKYNKLQMLGDDLRTDKKIILVEDLPNQFYRDSHTLH
EVLRKYVRIGRCPLIFIISDSLSGDNNQRLLFPKEIQEECSISNISFNPVAPTIMMKFLN
RIVTIEANKNGGKITVPDKTSLELLCQGCSGDIRSAINSLQFSSSKGENNLRPRKKGMSL
KSDAVLSKSKRRKKPDRVFENQEVQAIGGKDVSLFLFRALGKILYCKRASLTELDSPRLP
SHLSEYERDTLLVEPEEVVEMSHMPGDLFNLYLHQNYIDFFMEIDDIVRASEFLSFADIL
SGDWNTRSLLREYSTSIATRGVMHSNKARGYAHCQGGGSSFRPLHKPQWFLINKKYRENC
LAAKALFPDFCLPALCLQTQLLPYLALLTIPMRNQAQISFIQDIGRLPLKRHFGRLKMEA
LTDREHGMIDPDSGDEAQLNGGHSAEESLGEPTQATVPETWSLPLSQNSASELPASQPQP
FSAQGDMEENIIIEDYESDGT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75943	1.000	1.000	0.000	681	1.000	1.000	O75943.pdb.gz	RAD17_HUMAN Cell cycle checkpoint protein RAD17 OS=Homo sapiens OX=9606 GN=RAD17 PE=1 SV=2
2	AFDB:Q6NXW6	0.827	0.819	3.195E-89	688	0.818	0.810	Q6NXW6.pdb.gz	RAD17_MOUSE Cell cycle checkpoint protein RAD17 OS=Mus musculus OX=10090 GN=Rad17 PE=1 SV=2
3	AFDB:Q76F78	0.681	0.668	2.150E-66	694	0.565	0.555	Q76F78.pdb.gz	Q76F78_CHICK Rad17 OS=Gallus gallus OX=9031 GN=rad17 PE=2 SV=1
4	PDB:7z6hK	0.569	0.848	6.372E-56	439	0.642	0.995	7z6hK.pdb.gz	Structure of the human RAD17-RFC clamp loader and 9-1-1 checkpoint clamp bound to a dsDNA-ssDNA junction.
5	AFDB:Q9MBA3	0.514	0.575	3.148E-29	599	0.204	0.232	Q9MBA3.pdb.gz	RAD17_ARATH Cell cycle checkpoint protein RAD17 OS=Arabidopsis thaliana OX=3702 GN=RAD17 PE=1 SV=1
6	AFDB:P50531	0.370	0.410	2.331E-23	606	0.198	0.223	P50531.pdb.gz	RAD17_SCHPO Checkpoint protein rad17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rad17 PE=1 SV=1
7	PDB:7st9A	0.389	0.487	1.425E-15	522	0.151	0.197	7st9A.pdb.gz	Mechanisms of loading and release of the 9-1-1 checkpoint clamp.
8	AFDB:P35600	0.423	0.307	3.380E-14	986	0.153	0.105	P35600.pdb.gz	RFC1_DROME Replication factor C subunit 1 OS=Drosophila melanogaster OX=7227 GN=Gnf1 PE=1 SV=2
9	AFDB:P35251	0.440	0.276	1.119E-13	1148	0.137	0.081	P35251.pdb.gz	RFC1_HUMAN Replication factor C subunit 1 OS=Homo sapiens OX=9606 GN=RFC1 PE=1 SV=4
10	PDB:7steA	0.286	0.403	2.959E-13	468	0.148	0.216	7steA.pdb.gz	Mechanisms of loading and release of the 9-1-1 checkpoint clamp.
11	AFDB:D3ZFT1	0.445	0.282	1.109E-12	1131	0.128	0.077	D3ZFT1.pdb.gz	D3ZFT1_RAT Replication factor C subunit 1 OS=Rattus norvegicus OX=10116 GN=Rfc1 PE=1 SV=3
12	AFDB:F4I5S3	0.416	0.310	9.470E-12	943	0.173	0.125	F4I5S3.pdb.gz	F4I5S3_ARATH P-loop containing nucleoside triphosphate hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=CTF18 PE=1 SV=1
13	PDB:8dr5A	0.397	0.417	2.884E-10	646	0.129	0.136	8dr5A.pdb.gz	Multistep loading of a DNA sliding clamp onto DNA by replication factor C.
14	AFDB:Q96S55	0.326	0.333	3.239E-9	665	0.129	0.132	Q96S55.pdb.gz	WRIP1_HUMAN ATPase WRNIP1 OS=Homo sapiens OX=9606 GN=WRNIP1 PE=1 SV=2
15	PDB:7tfhB	0.300	0.571	5.203E-9	320	0.097	0.206	7tfhB.pdb.gz	Cryo-EM structures reveal that RFC recognizes both the 3'- and 5'-DNA ends to load PCNA onto gaps for DNA repair.
16	PDB:7tfkA	0.368	0.652	6.042E-9	360	0.100	0.189	7tfkA.pdb.gz	Cryo-EM structures reveal that RFC recognizes both the 3'- and 5'-DNA ends to load PCNA onto gaps for DNA repair.
17	PDB:6vvoB	0.250	0.463	2.210E-8	316	0.085	0.184	6vvoB.pdb.gz	Structure of the human clamp loader bound to the sliding clamp: a further twist on AAA+ mechanism
18	PDB:8dqwE	0.286	0.496	4.020E-8	354	0.110	0.212	8dqwE.pdb.gz	Multistep loading of a DNA sliding clamp onto DNA by replication factor C.
19	PDB:8dqxC	0.284	0.503	4.669E-8	330	0.098	0.203	8dqxC.pdb.gz	Multistep loading of a DNA sliding clamp onto DNA by replication factor C.
20	PDB:7z6hD	0.279	0.510	5.158E-8	324	0.101	0.213	7z6hD.pdb.gz	Structure of the human RAD17-RFC clamp loader and 9-1-1 checkpoint clamp bound to a dsDNA-ssDNA junction.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75943	0.0	1413	681	1.000	1.000	RAD17_HUMAN Cell cycle checkpoint protein RAD17 OS=Homo sapiens OX=9606 GN=RAD17 PE=1 SV=2
2	Q6NXW6	0.0	1140	688	0.803	0.795	RAD17_MOUSE Cell cycle checkpoint protein RAD17 OS=Mus musculus OX=10090 GN=Rad17 PE=1 SV=2
3	Q76F78	0.0	783	694	0.586	0.575	Q76F78_CHICK Rad17 OS=Gallus gallus OX=9031 GN=rad17 PE=2 SV=1
4	Q9MBA3	1.31e-34	141	599	0.201	0.229	RAD17_ARATH Cell cycle checkpoint protein RAD17 OS=Arabidopsis thaliana OX=3702 GN=RAD17 PE=1 SV=1
5	P50531	5.60e-34	139	606	0.194	0.218	RAD17_SCHPO Checkpoint protein rad17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rad17 PE=1 SV=1
6	P32641	1.30e-16	86.3	659	0.123	0.127	RAD24_YEAST Checkpoint protein RAD24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD24 PE=1 SV=1
7	Q383X4	2.20e-06	52.8	341	0.093	0.185	Q383X4_TRYB2 Replication factor C, subunit 4, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1310 PE=3 SV=1
8	Q9D0F6	2.70e-06	52.4	339	0.095	0.192	RFC5_MOUSE Replication factor C subunit 5 OS=Mus musculus OX=10090 GN=Rfc5 PE=1 SV=1
9	P40937	3.80e-06	52.0	340	0.095	0.191	RFC5_HUMAN Replication factor C subunit 5 OS=Homo sapiens OX=9606 GN=RFC5 PE=1 SV=1
10	Q9CAQ8	4.06e-06	52.0	369	0.084	0.154	RFC5_ARATH Replication factor C subunit 5 OS=Arabidopsis thaliana OX=3702 GN=RFC5 PE=1 SV=1
11	Q38DH5	3.03e-05	49.3	357	0.100	0.190	Q38DH5_TRYB2 Replication factor C, subunit 3, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.3310 PE=3 SV=1
12	P38629	3.11e-05	48.9	340	0.051	0.103	RFC3_YEAST Replication factor C subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RFC3 PE=1 SV=1
13	Q6DRK4	6.91e-05	47.8	334	0.091	0.186	Q6DRK4_DANRE Replication factor C (activator 1) 5 OS=Danio rerio OX=7955 GN=zgc:110313 PE=1 SV=1
14	Q96QE3	1.29e-04	48.1	1844	0.056	0.021	ATAD5_HUMAN ATPase family AAA domain-containing protein 5 OS=Homo sapiens OX=9606 GN=ATAD5 PE=1 SV=4
15	Q585Y7	1.46e-04	47.0	347	0.095	0.187	Q585Y7_TRYB2 Replication factor C, subunit 2, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4F7.530 PE=3 SV=1
16	Q9CAM7	7.29e-04	44.7	333	0.090	0.183	RFC2_ARATH Replication factor C subunit 2 OS=Arabidopsis thaliana OX=3702 GN=RFC2 PE=1 SV=1
17	O14003	8.31e-04	44.7	342	0.048	0.096	RFC3_SCHPO Replication factor C subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rfc3 PE=1 SV=2
18	Q93ZX1	8.32e-04	44.7	339	0.094	0.189	RFC4_ARATH Replication factor C subunit 4 OS=Arabidopsis thaliana OX=3702 GN=RFC4 PE=1 SV=1
19	F4HY43	0.001	43.9	341	0.094	0.188	F4HY43_ARATH ATPase family associated with various cellular activities (AAA) OS=Arabidopsis thaliana OX=3702 GN=EMB1968 PE=1 SV=1
20	P40348	0.001	43.9	353	0.032	0.062	RFC2_YEAST Replication factor C subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RFC2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	0.74	21.7	ATPase family associated with various cellular activities (AAA)
2	PF13086 AAA_11	87	14.3	AAA domain
3	PF13173 AAA_14	53	15.3	AAA domain
4	PF13191 AAA_16	0.12	24.2	AAA ATPase domain
5	PF13207 AAA_17	49	15.8	AAA domain
6	PF13238 AAA_18	0.0091	28.0	AAA domain
7	PF13245 AAA_19	59	15.3	AAA domain
8	PF13401 AAA_22	1	21.1	AAA domain
9	PF13521 AAA_28	1.3	20.7	AAA domain
10	PF13604 AAA_30	97	14.1	AAA domain
11	PF13671 AAA_33	5.2e+02	12.2	AAA domain
12	PF07728 AAA_5	4.2e+02	12.3	AAA domain (dynein-related subfamily)
13	PF16193 AAA_assoc_2	51	15.6	AAA C-terminal domain
14	PF00005 ABC_tran	3.7	19.5	ABC transporter
15	PF01637 ATPase_2	2.3e+02	13.1	ATPase domain predominantly from Archaea
16	PF03474 DMA	1.8e+02	13.1	DMRTA motif
17	PF01712 dNK	2.1e+02	13.2	Deoxynucleoside kinase
18	PF09452 Mvb12	6.8e+02	12.1	ESCRT-I subunit Mvb12
19	PF03266 NTPase_1	3.9e+02	12.3	NTPase
20	PF03215 Rad17	1.5e-83	290.9	Rad17 P-loop domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000426191

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000055077	0.999	Replication factor C subunit 2
2	9606.ENSP00000258774	0.999	Checkpoint protein HUS1
3	9606.ENSP00000260810	0.999	DNA topoisomerase 2-binding protein 1
4	9606.ENSP00000311360	0.999	Cell cycle checkpoint control protein RAD9A
5	9606.ENSP00000343741	0.999	Serine/threonine-protein kinase ATR
6	9606.ENSP00000369411	0.999	Replication factor C subunit 3
7	9606.ENSP00000376272	0.999	Replication factor C subunit 4
8	9606.ENSP00000278616	0.998	Serine-protein kinase ATM
9	9606.ENSP00000312995	0.997	Claspin
10	9606.ENSP00000408295	0.996	Replication factor C subunit 5
11	9606.ENSP00000307288	0.994	DNA replication licensing factor MCM7
12	9606.ENSP00000371469	0.994	Cell cycle checkpoint protein RAD1
13	9606.ENSP00000388648	0.993	Serine/threonine-protein kinase Chk1
14	9606.ENSP00000323099	0.992	ATR-interacting protein
15	9606.ENSP00000261881	0.990	TIMELESS-interacting protein
16	9606.ENSP00000254719	0.989	Replication protein A 70 kDa DNA-binding subunit
17	9606.ENSP00000313171	0.982	ATPase family AAA domain-containing protein 5
18	9606.ENSP00000363017	0.982	Replication protein A 32 kDa subunit
19	9606.ENSP00000371321	0.980	Replication factor C subunit 1
20	9606.ENSP00000265433	0.978	Nibrin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.942	catalytic activity
GO:0140657	0.710	ATP-dependent activity
GO:0016787	0.429	hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006950	0.995	response to stress
GO:0051716	0.995	cellular response to stimulus
GO:0006974	0.994	cellular response to DNA damage stimulus
GO:0071704	0.993	organic substance metabolic process
GO:0044238	0.992	primary metabolic process
GO:0044237	0.992	cellular metabolic process
GO:0080090	0.987	regulation of primary metabolic process
GO:0060255	0.987	regulation of macromolecule metabolic process
GO:0031323	0.987	regulation of cellular metabolic process
GO:0051171	0.986	regulation of nitrogen compound metabolic process
GO:0051052	0.983	regulation of DNA metabolic process
GO:0048523	0.979	negative regulation of cellular process
GO:1901987	0.977	regulation of cell cycle phase transition
GO:0006807	0.973	nitrogen compound metabolic process
GO:0043170	0.955	macromolecule metabolic process
GO:0042770	0.948	signal transduction in response to DNA damage
GO:0022402	0.946	cell cycle process
GO:0031570	0.944	DNA integrity checkpoint signaling
GO:0006259	0.936	DNA metabolic process
GO:0000077	0.899	DNA damage checkpoint signaling
GO:0007346	0.851	regulation of mitotic cell cycle
GO:0006281	0.844	DNA repair
GO:0044774	0.803	mitotic DNA integrity checkpoint signaling
GO:0006275	0.778	regulation of DNA replication
GO:0044773	0.659	mitotic DNA damage checkpoint signaling
GO:0009892	0.627	negative regulation of metabolic process
GO:0000076	0.613	DNA replication checkpoint signaling
GO:0045934	0.565	negative regulation of nucleobase-containing compound metabolic process
GO:0010605	0.544	negative regulation of macromolecule metabolic process
GO:0051053	0.433	negative regulation of DNA metabolic process
GO:0008156	0.370	negative regulation of DNA replication
GO:0042325	0.304	regulation of phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0005694	0.972	chromosome
GO:0098687	0.897	chromosomal region
GO:0000781	0.887	chromosome, telomeric region
GO:0005730	0.753	nucleolus
GO:0032991	0.598	protein-containing complex
GO:0005737	0.549	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.429	Hydrolases.

[back to server]