StarFunc result for job id O75947

User Input

>input (161 residues)
MAGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKAN
VAKAGLVDDFEKKFNALKVPVPEDKYTAQVDAEEKEDVKSCAEWVSLSKARIVEYEKEME
KMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75947	1.000	1.000	3.235E-26	161	1.000	1.000	O75947.pdb.gz	ATP5H_HUMAN ATP synthase subunit d, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PD PE=1 SV=3
2	AFDB:P13620	0.972	0.972	2.376E-23	161	0.882	0.882	P13620.pdb.gz	ATP5H_BOVIN ATP synthase subunit d, mitochondrial OS=Bos taurus OX=9913 GN=ATP5PD PE=1 SV=2
3	AFDB:P31399	0.972	0.972	4.891E-22	161	0.783	0.783	P31399.pdb.gz	ATP5H_RAT ATP synthase subunit d, mitochondrial OS=Rattus norvegicus OX=10116 GN=Atp5pd PE=1 SV=3
4	AFDB:Q9DCX2	0.940	0.940	1.281E-21	161	0.814	0.814	Q9DCX2.pdb.gz	ATP5H_MOUSE ATP synthase subunit d, mitochondrial OS=Mus musculus OX=10090 GN=Atp5pd PE=1 SV=3
5	PDB:6yy0d	0.555	0.568	3.714E-19	156	0.851	0.878	6yy0d.pdb.gz	Structure of the dimeric ATP synthase from bovine mitochondria.
6	AFDB:Q24251	0.760	0.698	3.031E-12	178	0.453	0.410	Q24251.pdb.gz	ATP5H_DROME ATP synthase subunit d, mitochondrial OS=Drosophila melanogaster OX=7227 GN=ATPsynD PE=2 SV=2
7	AFDB:A1ZAH1	0.580	0.167	3.036E-6	734	0.286	0.063	A1ZAH1.pdb.gz	A1ZAH1_DROME ATP synthase subunit d, mitochondrial OS=Drosophila melanogaster OX=7227 GN=knon PE=2 SV=1
8	AFDB:O94390	0.617	0.575	8.812E-5	175	0.217	0.200	O94390.pdb.gz	ATP7_SCHPO ATP synthase subunit d, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atp7 PE=3 SV=3
9	AFDB:P30902	0.476	0.448	8.812E-5	174	0.199	0.184	P30902.pdb.gz	ATP7_YEAST ATP synthase subunit d, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATP7 PE=1 SV=2
10	AFDB:Q9FT52	0.485	0.472	1.243E-4	168	0.248	0.238	Q9FT52.pdb.gz	ATP5H_ARATH ATP synthase subunit d, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At3g52300 PE=1 SV=3
11	AFDB:Q59PV8	0.571	0.540	9.772E-4	174	0.193	0.178	Q59PV8.pdb.gz	Q59PV8_CANAL ATP synthase subunit d, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ATP7 PE=3 SV=1
12	PDB:7d4iA9	0.204	0.242	3.606	128	0.099	0.125	7d4iA9.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
13	PDB:8ap8d	0.311	0.220	4.748	270	0.149	0.089	8ap8d.pdb.gz
14	PDB:6elzJ	0.157	0.173	5.085	145	0.149	0.166	6elzJ.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
15	PDB:7nvrk	0.211	0.250	5.447	133	0.168	0.203	7nvrk.pdb.gz	Structures of mammalian RNA polymerase II pre-initiation complexes.
16	PDB:7yyhK	0.240	0.185	7.171	217	0.112	0.083	7yyhK.pdb.gz	Structure of the human inner kinetochore bound to a centromeric CENP-A nucleosome.
17	PDB:6wucK	0.259	0.181	7.681	235	0.130	0.089	6wucK.pdb.gz
18	PDB:7wtxt	0.211	0.248	7.681	132	0.106	0.129	7wtxt.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
19	PDB:7o4hB	0.124	0.058	8.813	468	0.112	0.038	7o4hB.pdb.gz
20	PDB:2kwbA	0.133	0.117	9.440	183	0.062	0.055	2kwbA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75947	1.33e-115	325	161	1.000	1.000	ATP5H_HUMAN ATP synthase subunit d, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PD PE=1 SV=3
2	P13620	2.13e-104	297	161	0.882	0.882	ATP5H_BOVIN ATP synthase subunit d, mitochondrial OS=Bos taurus OX=9913 GN=ATP5PD PE=1 SV=2
3	Q9DCX2	6.03e-97	278	161	0.814	0.814	ATP5H_MOUSE ATP synthase subunit d, mitochondrial OS=Mus musculus OX=10090 GN=Atp5pd PE=1 SV=3
4	P31399	1.20e-94	272	161	0.783	0.783	ATP5H_RAT ATP synthase subunit d, mitochondrial OS=Rattus norvegicus OX=10116 GN=Atp5pd PE=1 SV=3
5	Q24251	6.41e-44	144	178	0.453	0.410	ATP5H_DROME ATP synthase subunit d, mitochondrial OS=Drosophila melanogaster OX=7227 GN=ATPsynD PE=2 SV=2
6	A1ZAH1	5.04e-11	62.0	734	0.286	0.063	A1ZAH1_DROME ATP synthase subunit d, mitochondrial OS=Drosophila melanogaster OX=7227 GN=knon PE=2 SV=1
7	Q9FT52	1.35e-06	47.8	168	0.155	0.149	ATP5H_ARATH ATP synthase subunit d, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At3g52300 PE=1 SV=3
8	P30902	3.91e-06	46.6	174	0.211	0.195	ATP7_YEAST ATP synthase subunit d, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATP7 PE=1 SV=2
9	O94390	1.10e-05	45.4	175	0.217	0.200	ATP7_SCHPO ATP synthase subunit d, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atp7 PE=3 SV=3
10	Q9US48	0.38	33.1	581	0.099	0.028	GAA1_SCHPO GPI transamidase component gaa1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gaa1 PE=3 SV=1
11	Q59PV8	0.64	32.0	174	0.149	0.138	Q59PV8_CANAL ATP synthase subunit d, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ATP7 PE=3 SV=1
12	Q8WUW1	0.67	30.4	75	0.130	0.280	BRK1_HUMAN Protein BRICK1 OS=Homo sapiens OX=9606 GN=BRK1 PE=1 SV=1
13	Q91VR8	1.6	29.6	75	0.124	0.267	BRK1_MOUSE Protein BRICK1 OS=Mus musculus OX=10090 GN=Brk1 PE=1 SV=1
14	Q7Z2W7	2.1	30.8	1104	0.143	0.021	TRPM8_HUMAN Transient receptor potential cation channel subfamily M member 8 OS=Homo sapiens OX=9606 GN=TRPM8 PE=1 SV=2
15	K4CWS6	2.2	30.8	470	0.174	0.060	U75C1_SOLLC UDP-glycosyltransferase 75C1 OS=Solanum lycopersicum OX=4081 GN=UGT75C1 PE=1 SV=1
16	Q8CHG3	2.2	30.8	1680	0.230	0.022	GCC2_MOUSE GRIP and coiled-coil domain-containing protein 2 OS=Mus musculus OX=10090 GN=Gcc2 PE=1 SV=3
17	Q8R455	2.5	30.8	1104	0.143	0.021	TRPM8_RAT Transient receptor potential cation channel subfamily M member 8 OS=Rattus norvegicus OX=10116 GN=Trpm8 PE=1 SV=4
18	Q10215	3.5	29.6	142	0.106	0.120	RDL_SCHPO Putative thiosulfate sulfurtransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4H3.07c PE=3 SV=2
19	Q8R4D5	5.4	29.6	1104	0.143	0.021	TRPM8_MOUSE Transient receptor potential cation channel subfamily M member 8 OS=Mus musculus OX=10090 GN=Trpm8 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01614 IclR	3.3e+02	12.6	Bacterial transcriptional regulator
2	PF05873 Mt_ATP-synt_D	5.5e-63	222.9	ATP synthase D chain, mitochondrial (ATP5H)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000301587

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000215375	0.999	ATP synthase subunit delta, mitochondrial
2	9606.ENSP00000243997	0.999	ATP synthase subunit epsilon, mitochondrial
3	9606.ENSP00000262030	0.999	ATP synthase subunit beta, mitochondrial
4	9606.ENSP00000290299	0.999	ATP synthase subunit O, mitochondrial
5	9606.ENSP00000292475	0.999	ATP synthase subunit f, mitochondrial
6	9606.ENSP00000300688	0.999	ATP synthase subunit g, mitochondrial
7	9606.ENSP00000306003	0.999	ATP synthase subunit e, mitochondrial
8	9606.ENSP00000349142	0.999	ATP synthase subunit gamma, mitochondrial
9	9606.ENSP00000358737	0.999	ATP synthase F(0) complex subunit B1, mitochondrial
10	9606.ENSP00000381736	0.999	ATP synthase subunit alpha, mitochondrial
11	9606.ENSP00000389649	0.999	ATP synthase-coupling factor 6, mitochondrial
12	9606.ENSP00000354632	0.997	ATP synthase subunit a
13	9606.ENSP00000377033	0.997	ATP synthase F(0) complex subunit C1, mitochondrial
14	9606.ENSP00000284727	0.994	ATP synthase F(0) complex subunit C3, mitochondrial
15	9606.ENSP00000377878	0.989	ATP synthase F(0) complex subunit C2, mitochondrial
16	9606.ENSP00000421076	0.989	ATP synthase subunit g 2, mitochondrial
17	9606.ENSP00000355265	0.983	ATP synthase protein 8
18	9606.ENSP00000370414	0.983	ATP synthase subunit epsilon-like protein, mitochondrial
19	9606.ENSP00000358840	0.982	Up-regulated during skeletal muscle growth protein 5
20	9606.ENSP00000428895	0.982	Cytochrome c oxidase subunit 6C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0046933	0.999	proton-transporting ATP synthase activity, rotational mechanism
GO:0044877	0.526	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0044238	0.987	primary metabolic process
GO:1901564	0.986	organonitrogen compound metabolic process
GO:0006091	0.985	generation of precursor metabolites and energy
GO:0034641	0.985	cellular nitrogen compound metabolic process
GO:0045333	0.983	cellular respiration
GO:0046034	0.980	ATP metabolic process
GO:0006119	0.969	oxidative phosphorylation
GO:0044271	0.928	cellular nitrogen compound biosynthetic process
GO:1901576	0.916	organic substance biosynthetic process
GO:1901293	0.902	nucleoside phosphate biosynthetic process
GO:1901566	0.901	organonitrogen compound biosynthetic process
GO:0009260	0.856	ribonucleotide biosynthetic process
GO:0015986	0.851	proton motive force-driven ATP synthesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1902494	0.999	catalytic complex
GO:0098800	0.999	inner mitochondrial membrane protein complex
GO:0016469	0.978	proton-transporting two-sector ATPase complex
GO:0005753	0.973	mitochondrial proton-transporting ATP synthase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:57720	0.999	ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate
EC:7.1.2.2	0.999	H(+)-transporting two-sector ATPase.

[back to server]