StarFunc result for job id O75952

User Input

>input (493 residues)
MISSKPRLVVPYGLKTLLEGISRAVLKTNPSNINQFAAAYFQELTMYRGNTTMDIKDLVK
QFHQIKVEKWSEGTTPQKKLECLKEPGKTSVESKVPTQMEKSTDTDEDNVTRTEYSDKTT
QFPSVYAVPGTEQTEAVGGLSSKPATPKTTTPPSSPPPTAVSPEFAYVPADPAQLAAQML
GKVSSIHSDQSDVLMVDVATSMPVVIKEVPSSEAAEDVMVAAPLVCSGKVLEVQVVNQTS
VHVDLGSQPKENEAEPSTASSVPLQDEQEPPAYDQAPEVTLQADIEVMSTVHISSVYNDV
PVTEGVVYIEQLPEQIVIPFTDQVACLKENEQSKENEQSPRVSPKSVVEKTTSGMSKKSV
ESVKLAQLEENAKYSSVYMEAEATALLSDTSLKGQPEVPAQLLDAEGAIKIGSEKSLHLE
VEITSIVSDNTGQEESGENSVPQEMEGKPVLSGEAAEAVHSGTSVKSSSGPFPPAPEGLT
APEIEPEGESTAE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RC21	0.275	0.275	4.059E-57	493	1.000	1.000	A0A024RC21.pdb.gz	A0A024RC21_HUMAN Calcium binding tyrosine-(Y)-phosphorylation regulated (Fibrousheathin 2), isoform CRA_c OS=Homo sapiens OX=9606 GN=CABYR PE=2 SV=1
2	AFDB:Q32L61	0.169	0.181	2.988E-29	454	0.564	0.612	Q32L61.pdb.gz	Q32L61_BOVIN Calcium binding tyrosine phosphorylation regulated OS=Bos taurus OX=9913 GN=CABYR PE=2 SV=1
3	AFDB:Q05AK7	0.105	0.080	2.181E-3	660	0.178	0.133	Q05AK7.pdb.gz	Q05AK7_DANRE Uncharacterized protein LOC564082 OS=Danio rerio OX=7955 GN=spa17 PE=2 SV=1
4	AFDB:Q63187	0.103	0.078	3.364E-1	773	0.136	0.087	Q63187.pdb.gz	ELOA1_RAT Elongin-A OS=Rattus norvegicus OX=10116 GN=Eloa PE=1 SV=1
5	AFDB:Q7JVP4	0.081	0.038	5.809E-1	1430	0.160	0.055	Q7JVP4.pdb.gz	BRDH_DROME Bromodomain-containing protein homolog OS=Drosophila melanogaster OX=7227 GN=Br140 PE=1 SV=1
6	AFDB:F4IAT2	0.060	0.026	6.173E-1	1823	0.146	0.039	F4IAT2.pdb.gz	THOC2_ARATH THO complex subunit 2 OS=Arabidopsis thaliana OX=3702 GN=THO2 PE=1 SV=1
7	AFDB:Q9NRH2	0.070	0.051	7.869E-1	765	0.146	0.094	Q9NRH2.pdb.gz	SNRK_HUMAN SNF-related serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=SNRK PE=1 SV=2
8	AFDB:A0A024R784	0.066	0.038	9.441E-1	1016	0.142	0.069	A0A024R784.pdb.gz
9	AFDB:A4FVR1	0.069	0.062	1.359	575	0.148	0.127	A4FVR1.pdb.gz	GIP1L_ARATH GBF-interacting protein 1-like OS=Arabidopsis thaliana OX=3702 GN=GIP1L PE=1 SV=1
10	AFDB:O15016	0.061	0.034	1.359	1216	0.170	0.069	O15016.pdb.gz	TRI66_HUMAN Tripartite motif-containing protein 66 OS=Homo sapiens OX=9606 GN=TRIM66 PE=1 SV=5
11	PDB:5jk7F	0.085	0.386	1.851	74	0.024	0.162	5jk7F.pdb.gz
12	PDB:5yzg3	0.038	0.099	1.967	171	0.012	0.035	5yzg3.pdb.gz	Structure of a human catalytic step I spliceosome
13	PDB:7qsmW	0.086	0.254	1.967	116	0.018	0.078	7qsmW.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
14	PDB:1suwA	0.033	0.061	2.090	249	0.004	0.008	1suwA.pdb.gz	Crystal Structures of an NAD Kinase from Archaeoglobus fulgidus in Complex with ATP, NAD, or NADP
15	PDB:5nj5A	0.038	0.039	2.090	480	0.014	0.015	5nj5A.pdb.gz	The Origins of Specificity in the Microcin-Processing Protease TldD/E.
16	PDB:7aqrV	0.090	0.244	2.360	140	0.026	0.093	7aqrV.pdb.gz	A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
17	PDB:2vldA	0.056	0.109	2.508	228	0.012	0.026	2vldA.pdb.gz
18	PDB:4n1mA	0.044	0.110	2.665	168	0.010	0.030	4n1mA.pdb.gz	Mapping the binding surface of Cyclophilin A.
19	PDB:6jzcB	0.074	0.139	2.665	253	0.006	0.012	6jzcB.pdb.gz
20	PDB:7lq1A	0.054	0.030	2.665	950	0.008	0.004	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A024RC21	0.0	984	493	1.000	1.000	A0A024RC21_HUMAN Calcium binding tyrosine-(Y)-phosphorylation regulated (Fibrousheathin 2), isoform CRA_c OS=Homo sapiens OX=9606 GN=CABYR PE=2 SV=1
2	A0A0D9SFQ2	0.0	777	395	0.801	1.000	A0A0D9SFQ2_HUMAN Calcium binding tyrosine phosphorylation regulated OS=Homo sapiens OX=9606 GN=CABYR PE=1 SV=1
3	J3KTE8	0.0	570	293	0.592	0.997	J3KTE8_HUMAN Calcium binding tyrosine phosphorylation regulated (Fragment) OS=Homo sapiens OX=9606 GN=CABYR PE=1 SV=1
4	O75952	0.0	984	493	1.000	1.000	CABYR_HUMAN Calcium-binding tyrosine phosphorylation-regulated protein OS=Homo sapiens OX=9606 GN=CABYR PE=1 SV=2
5	Q32L61	1.24e-168	485	454	0.588	0.639	Q32L61_BOVIN Calcium binding tyrosine phosphorylation regulated OS=Bos taurus OX=9913 GN=CABYR PE=2 SV=1
6	Q9D424	2.35e-167	482	453	0.596	0.649	CABYR_MOUSE Calcium-binding tyrosine phosphorylation-regulated protein OS=Mus musculus OX=10090 GN=Cabyr PE=1 SV=1
7	Q15506	2.08e-06	49.7	151	0.045	0.146	SP17_HUMAN Sperm surface protein Sp17 OS=Homo sapiens OX=9606 GN=SPA17 PE=1 SV=1
8	Q62252	2.45e-06	49.3	149	0.043	0.141	SP17_MOUSE Sperm surface protein Sp17 OS=Mus musculus OX=10090 GN=Spa17 PE=1 SV=1
9	F1QK17	4.60e-06	51.6	646	0.051	0.039	F1QK17_DANRE Sperm autoantigenic protein 17 OS=Danio rerio OX=7955 GN=spa17 PE=1 SV=1
10	Q05AK7	4.93e-06	51.6	660	0.051	0.038	Q05AK7_DANRE Uncharacterized protein LOC564082 OS=Danio rerio OX=7955 GN=spa17 PE=2 SV=1
11	P36425	6.49e-04	42.4	146	0.043	0.144	SP17_RABIT Sperm surface protein Sp17 OS=Oryctolagus cuniculus OX=9986 GN=SPA17 PE=1 SV=2
12	Q6FM61	1.3	34.3	593	0.053	0.044	Q6FM61_CANGA Candida glabrata strain CBS138 chromosome K complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CYB2 PE=4 SV=1
13	A9C3T0	1.9	33.5	397	0.028	0.035	A9C3T0_DANRE Protein kinase, cAMP-dependent, regulatory, type II, alpha A OS=Danio rerio OX=7955 GN=wu:fb55f12 PE=1 SV=1
14	Q08BH1	1.9	33.5	397	0.028	0.035	Q08BH1_DANRE Prkar2aa protein OS=Danio rerio OX=7955 GN=prkar2aa PE=2 SV=1
15	K9N7C7	3.2	33.1	7078	0.059	0.004	R1AB_MERS1 Replicase polyprotein 1ab OS=Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) OX=1263720 GN=rep PE=1 SV=1
16	Q9ESG2	4.1	32.0	212	0.053	0.123	ROP1_MOUSE Ropporin-1 OS=Mus musculus OX=10090 GN=Ropn1 PE=1 SV=1
17	P12369	4.5	32.3	416	0.026	0.031	KAP3_RAT cAMP-dependent protein kinase type II-beta regulatory subunit OS=Rattus norvegicus OX=10116 GN=Prkar2b PE=1 SV=3
18	Q8IIZ5	4.6	32.7	2182	0.053	0.012	Q8IIZ5_PLAF7 Erythrocyte membrane protein 1, PfEMP1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1100100 PE=4 SV=1
19	P31323	4.9	32.0	418	0.026	0.031	KAP3_HUMAN cAMP-dependent protein kinase type II-beta regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2B PE=1 SV=3
20	P31324	4.9	32.0	416	0.026	0.031	KAP3_MOUSE cAMP-dependent protein kinase type II-beta regulatory subunit OS=Mus musculus OX=10090 GN=Prkar2b PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02197 RIIa	9.8e-12	55.7	Regulatory subunit of type II PKA R-subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000483621

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344579	0.933	Fibrous sheath CABYR-binding protein
2	9606.ENSP00000184183	0.932	Ropporin-1A
3	9606.ENSP00000421405	0.906	Ropporin-1-like protein
4	9606.ENSP00000228850	0.884	A-kinase anchor protein 3
5	9606.ENSP00000432305	0.829	Sperm surface protein Sp17
6	9606.ENSP00000339179	0.746	Testis-specific serine/threonine-protein kinase 4
7	9606.ENSP00000349568	0.746	Cilia and flagella associated protein 43
8	9606.ENSP00000351327	0.746	A-kinase anchor protein 4
9	9606.ENSP00000378830	0.746	Glutamine-rich protein 1
10	9606.ENSP00000373948	0.735	Cilia- and flagella-associated protein 69
11	9606.ENSP00000289013	0.733	Rhophilin-1
12	9606.ENSP00000403453	0.732	Outer dense fiber protein 2
13	9606.ENSP00000463080	0.729	Probable E3 ubiquitin-protein ligase MARCH10
14	9606.ENSP00000265563	0.726	cAMP-dependent protein kinase type II-alpha regulatory subunit
15	9606.ENSP00000360913	0.711	Spermatogenesis-associated protein 6
16	9606.ENSP00000312399	0.707	Coiled-coil domain-containing protein 63
17	9606.ENSP00000401514	0.700	Dynein heavy chain 1, axonemal
18	9606.ENSP00000405708	0.688	Coiled-coil domain-containing protein 39
19	9606.ENSP00000478212	0.680	A-kinase anchor protein 1, mitochondrial
20	9606.ENSP00000295201	0.649	Tektin-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005509	0.999	calcium ion binding
GO:0019899	0.992	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0071840	0.741	cellular component organization or biogenesis
GO:0016043	0.733	cellular component organization
GO:0065007	0.648	biological regulation
GO:0032501	0.536	multicellular organismal process
GO:0050789	0.525	regulation of biological process
GO:0050794	0.485	regulation of cellular process
GO:0032502	0.432	developmental process
GO:0000003	0.350	reproduction
GO:0022414	0.320	reproductive process
GO:0048856	0.312	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.999	nucleoplasm
GO:0005929	0.930	cilium
GO:0031514	0.889	motile cilium
GO:0097729	0.832	9+2 motile cilium
GO:0036126	0.814	sperm flagellum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]