StarFunc result for job id O75953

User Input

>input (348 residues)
MGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAEEKFKEIAEAYDVLSDPKK
RGLYDQYGEEGLKTGGGTSGGSSGSFHYTFHGDPHATFASFFGGSNPFDIFFASSRSTRP
FSGFDPDDMDVDEDEDPFGAFGRFGFNGLSRGPRRAPEPLYPRRKVQDPPVVHELRVSLE
EIYHGSTKRMKITRRRLNPDGRTVRTEDKILHIVIKRGWKEGTKITFPKEGDATPDNIPA
DIVFVLKDKPHAHFRRDGTNVLYSALISLKEALCGCTVNIPTIDGRVIPLPCNDVIKPGT
VKRLRGEGLPFPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQHLPCS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75953	1.000	1.000	8.259E-73	348	1.000	1.000	O75953.pdb.gz	DNJB5_HUMAN DnaJ homolog subfamily B member 5 OS=Homo sapiens OX=9606 GN=DNAJB5 PE=1 SV=1
2	AFDB:Q9UDY4	0.884	0.912	4.096E-56	337	0.635	0.656	Q9UDY4.pdb.gz	DNJB4_HUMAN DnaJ homolog subfamily B member 4 OS=Homo sapiens OX=9606 GN=DNAJB4 PE=1 SV=1
3	AFDB:B0K030	0.544	0.557	9.519E-54	340	0.649	0.665	B0K030.pdb.gz	B0K030_RAT DnaJ (Hsp40) homolog, subfamily B, member 1 (Predicted), isoform CRA_b OS=Rattus norvegicus OX=10116 GN=Dnajb1 PE=2 SV=1
4	AFDB:A0A0R4IYH3	0.556	0.577	1.638E-52	335	0.621	0.645	A0A0R4IYH3.pdb.gz
5	AFDB:B8JM56	0.553	0.565	2.659E-52	340	0.578	0.591	B8JM56.pdb.gz
6	AFDB:Q20774	0.661	0.689	1.349E-46	331	0.537	0.565	Q20774.pdb.gz	Q20774_CAEEL J domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dnj-13 PE=1 SV=1
7	AFDB:Q24133	0.525	0.547	1.614E-45	334	0.511	0.533	Q24133.pdb.gz	DNAJ1_DROME DnaJ protein homolog 1 OS=Drosophila melanogaster OX=7227 GN=DnaJ-1 PE=1 SV=3
8	AFDB:P59910	0.508	0.558	1.932E-44	316	0.463	0.509	P59910.pdb.gz	DJB13_HUMAN DnaJ homolog subfamily B member 13 OS=Homo sapiens OX=9606 GN=DNAJB13 PE=1 SV=1
9	AFDB:Q80Y75	0.520	0.571	2.044E-42	316	0.445	0.491	Q80Y75.pdb.gz	DJB13_MOUSE DnaJ homolog subfamily B member 13 OS=Mus musculus OX=10090 GN=Dnajb13 PE=1 SV=1
10	AFDB:D3ZUU5	0.633	0.597	1.412E-39	371	0.557	0.523	D3ZUU5.pdb.gz	D3ZUU5_RAT DnaJ heat shock protein family (Hsp40) member B1 OS=Rattus norvegicus OX=10116 GN=Dnajb1 PE=4 SV=1
11	PDB:6byrA	0.191	0.164	6.784E-6	405	0.147	0.126	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
12	PDB:7x3kA	0.180	0.237	1.577E-3	262	0.098	0.130	7x3kA.pdb.gz
13	PDB:2y4uA	0.153	0.126	6.742E-3	424	0.092	0.075	2y4uA.pdb.gz
14	PDB:5y88T	0.154	0.445	8.589E-3	107	0.063	0.206	5y88T.pdb.gz	Structure of an Intron Lariat Spliceosome from Saccharomyces cerevisiae
15	PDB:7sqcO0	0.138	0.058	5.960E-2	1140	0.066	0.020	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
16	PDB:7sqcO1	0.151	0.101	1.160E-1	673	0.063	0.033	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
17	PDB:8dnuA	0.072	0.069	5.948E-1	370	0.029	0.027	8dnuA.pdb.gz	A cryo-electron microscopic approach to elucidate protein structures from human brain microsomes.
18	PDB:3kycB	0.110	0.078	7.578E-1	548	0.037	0.024	3kycB.pdb.gz	Active site remodelling accompanies thioester bond formation in the SUMO E1.
19	PDB:2uxtA	0.106	0.091	8.051E-1	422	0.057	0.047	2uxtA.pdb.gz
20	PDB:4aq1A	0.096	0.063	9.087E-1	721	0.089	0.043	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75953	0.0	710	348	1.000	1.000	DNJB5_HUMAN DnaJ homolog subfamily B member 5 OS=Homo sapiens OX=9606 GN=DNAJB5 PE=1 SV=1
2	O89114	0.0	705	348	0.991	0.991	DNJB5_MOUSE DnaJ homolog subfamily B member 5 OS=Mus musculus OX=10090 GN=Dnajb5 PE=2 SV=1
3	Q9UDY4	2.83e-158	448	337	0.638	0.659	DNJB4_HUMAN DnaJ homolog subfamily B member 4 OS=Homo sapiens OX=9606 GN=DNAJB4 PE=1 SV=1
4	B0K030	1.69e-146	419	340	0.635	0.650	B0K030_RAT DnaJ (Hsp40) homolog, subfamily B, member 1 (Predicted), isoform CRA_b OS=Rattus norvegicus OX=10116 GN=Dnajb1 PE=2 SV=1
5	P25685	3.27e-145	415	340	0.621	0.635	DNJB1_HUMAN DnaJ homolog subfamily B member 1 OS=Homo sapiens OX=9606 GN=DNAJB1 PE=1 SV=4
6	Q6FHS4	3.27e-145	415	340	0.621	0.635	Q6FHS4_HUMAN DNAJB1 protein (Fragment) OS=Homo sapiens OX=9606 GN=DNAJB1 PE=2 SV=1
7	Q9QYJ3	6.30e-145	414	340	0.626	0.641	DNJB1_MOUSE DnaJ homolog subfamily B member 1 OS=Mus musculus OX=10090 GN=Dnajb1 PE=1 SV=3
8	Q6DEJ4	8.37e-142	406	335	0.629	0.654	Q6DEJ4_DANRE DnaJ (Hsp40) homolog, subfamily B, member 1 OS=Danio rerio OX=7955 GN=dnajb1 PE=2 SV=1
9	Q7ZVY8	3.35e-139	400	337	0.580	0.599	Q7ZVY8_DANRE DnaJ homolog subfamily B member 1 OS=Danio rerio OX=7955 GN=zgc:55492 PE=1 SV=1
10	D3ZUU5	1.22e-118	349	371	0.537	0.504	D3ZUU5_RAT DnaJ heat shock protein family (Hsp40) member B1 OS=Rattus norvegicus OX=10116 GN=Dnajb1 PE=4 SV=1
11	Q24133	1.23e-112	332	334	0.520	0.542	DNAJ1_DROME DnaJ protein homolog 1 OS=Drosophila melanogaster OX=7227 GN=DnaJ-1 PE=1 SV=3
12	Q20774	1.91e-110	327	331	0.537	0.565	Q20774_CAEEL J domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dnj-13 PE=1 SV=1
13	M0QXK0	8.11e-110	323	273	0.497	0.634	M0QXK0_HUMAN DnaJ heat shock protein family (Hsp40) member B1 OS=Homo sapiens OX=9606 GN=DNAJB1 PE=1 SV=2
14	P59910	1.60e-100	301	316	0.457	0.503	DJB13_HUMAN DnaJ homolog subfamily B member 13 OS=Homo sapiens OX=9606 GN=DNAJB13 PE=1 SV=1
15	Q80Y75	4.16e-97	292	316	0.451	0.497	DJB13_MOUSE DnaJ homolog subfamily B member 13 OS=Mus musculus OX=10090 GN=Dnajb13 PE=1 SV=1
16	M0R080	4.29e-76	234	183	0.342	0.650	M0R080_HUMAN DnaJ homolog subfamily B member 1 (Fragment) OS=Homo sapiens OX=9606 GN=DNAJB1 PE=1 SV=1
17	C9JUL4	7.01e-67	210	172	0.339	0.686	C9JUL4_HUMAN DnaJ heat shock protein family (Hsp40) member B4 (Fragment) OS=Homo sapiens OX=9606 GN=DNAJB4 PE=1 SV=1
18	Q8I489	1.09e-65	214	402	0.368	0.318	Q8I489_PLAF7 Heat shock protein 40, type II OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0501100.1 PE=4 SV=2
19	O96212	1.62e-65	212	328	0.382	0.405	O96212_PLAF7 Protein SIS1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0213100 PE=4 SV=1
20	Q09912	9.23e-64	209	379	0.425	0.391	PSI1_SCHPO Protein psi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=psi1 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00226 DnaJ	1.7e-25	100.3	DnaJ domain
2	PF01556 DnaJ_C	3.2e-40	149.1	DnaJ C terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9544.ENSMMUP00000039415

Rank	PPI partner	STRING score	Description
1	9544.ENSMMUP00000017002	0.936	Stress-induced phosphoprotein 1
2	9544.ENSMMUP00000006240	0.921	Belongs to the heat shock protein 70 family.
3	9544.ENSMMUP00000008935	0.921	Uncharacterized protein
4	9544.ENSMMUP00000034046	0.911	Uncharacterized protein
5	9544.ENSMMUP00000034051	0.911	Uncharacterized protein
6	9544.ENSMMUP00000012300	0.858	Heat shock 70kDa protein 4
7	9544.ENSMMUP00000019984	0.854	Heat shock 70kDa protein 4-like
8	9544.ENSMMUP00000036445	0.854	Heat shock 105kDa/110kDa protein 1
9	9544.ENSMMUP00000002527	0.811	Uncharacterized protein
10	9544.ENSMMUP00000006904	0.811	Uncharacterized protein
11	9544.ENSMMUP00000006906	0.811	78 kDa glucose-regulated protein
12	9544.ENSMMUP00000022589	0.808	Heat shock protein family A (Hsp70) member 14
13	9544.ENSMMUP00000026445	0.804	Heat shock protein 70kDa family, member 13
14	9544.ENSMMUP00000007168	0.775	ClpB homolog, mitochondrial AAA ATPase chaperonin
15	9544.ENSMMUP00000010605	0.769	Uncharacterized protein
16	9544.ENSMMUP00000002781	0.757	Uncharacterized protein
17	9544.ENSMMUP00000010774	0.757	Uncharacterized protein
18	9544.ENSMMUP00000016126	0.757	Uncharacterized protein
19	9544.ENSMMUP00000016240	0.757	Uncharacterized protein
20	9544.ENSMMUP00000025472	0.757	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0051087	0.895	chaperone binding
GO:0098772	0.640	molecular function regulator activity
GO:0051082	0.378	unfolded protein binding
GO:0060590	0.327	ATPase regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.979	biological regulation
GO:0050794	0.958	regulation of cellular process
GO:0048519	0.763	negative regulation of biological process
GO:0048523	0.754	negative regulation of cellular process
GO:0031326	0.728	regulation of cellular biosynthetic process
GO:0060255	0.720	regulation of macromolecule metabolic process
GO:0010468	0.694	regulation of gene expression
GO:0080090	0.677	regulation of primary metabolic process
GO:0051171	0.677	regulation of nitrogen compound metabolic process
GO:0019219	0.667	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.654	regulation of macromolecule biosynthetic process
GO:0051252	0.632	regulation of RNA metabolic process
GO:0050896	0.624	response to stimulus
GO:2001141	0.617	regulation of RNA biosynthetic process
GO:0009892	0.608	negative regulation of metabolic process
GO:0010605	0.502	negative regulation of macromolecule metabolic process
GO:0006950	0.435	response to stress
GO:0009987	0.430	cellular process
GO:0006355	0.398	regulation of DNA-templated transcription
GO:0031324	0.394	negative regulation of cellular metabolic process
GO:0042221	0.393	response to chemical
GO:0035966	0.374	response to topologically incorrect protein
GO:0051172	0.368	negative regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043227	0.996	membrane-bounded organelle
GO:0043229	0.995	intracellular organelle
GO:0005829	0.991	cytosol
GO:0043231	0.980	intracellular membrane-bounded organelle
GO:0005634	0.960	nucleus
GO:0043232	0.875	intracellular non-membrane-bounded organelle
GO:0070013	0.405	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]