StarFunc result for job id O75955

User Input

>input (427 residues)
MFFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHG
VPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEI
YKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGE
AEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQL
QVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAEA
EKSQLIMQAEAEAASVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQEAAQLDMLLEK
LPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLTGVSISQVN
HKPLRTA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O08917	0.568	0.567	2.639E-59	428	0.984	0.981	O08917.pdb.gz	FLOT1_MOUSE Flotillin-1 OS=Mus musculus OX=10090 GN=Flot1 PE=1 SV=1
2	AFDB:O13127	0.615	0.620	2.539E-54	423	0.789	0.797	O13127.pdb.gz	FLOT1_CARAU Flotillin-1 OS=Carassius auratus OX=7957 GN=flot1 PE=1 SV=1
3	AFDB:B5X3E3	0.580	0.582	5.500E-53	426	0.787	0.789	B5X3E3.pdb.gz	B5X3E3_SALSA Flotillin OS=Salmo salar OX=8030 GN=FLOT1 PE=2 SV=1
4	AFDB:W5ULK7	0.592	0.594	2.716E-52	425	0.794	0.798	W5ULK7.pdb.gz	W5ULK7_ICTPU Flotillin OS=Ictalurus punctatus OX=7998 GN=flot1 PE=2 SV=1
5	AFDB:O61491	0.596	0.597	3.513E-47	426	0.637	0.638	O61491.pdb.gz	FLOT1_DROME Flotillin-1 OS=Drosophila melanogaster OX=7227 GN=Flo1 PE=2 SV=1
6	AFDB:Q98TZ8	0.549	0.548	1.808E-36	428	0.468	0.467	Q98TZ8.pdb.gz	FLOT2_DANRE Flotillin-2a OS=Danio rerio OX=7955 GN=flot2a PE=2 SV=2
7	AFDB:E7EMK3	0.484	0.432	4.941E-36	483	0.464	0.410	E7EMK3.pdb.gz	E7EMK3_HUMAN Flotillin OS=Homo sapiens OX=9606 GN=FLOT2 PE=1 SV=1
8	AFDB:J3QLD9	0.585	0.583	7.075E-35	428	0.429	0.428	J3QLD9.pdb.gz	J3QLD9_HUMAN Flotillin OS=Homo sapiens OX=9606 GN=FLOT2 PE=1 SV=1
9	AFDB:O61492	0.623	0.608	6.337E-33	438	0.431	0.420	O61492.pdb.gz	FLOT2_DROME Flotillin-2 OS=Drosophila melanogaster OX=7227 GN=Flo2 PE=2 SV=3
10	AFDB:Q9LV90	0.496	0.448	2.192E-18	479	0.190	0.169	Q9LV90.pdb.gz	FLOT3_ARATH Flotillin-like protein 3 OS=Arabidopsis thaliana OX=3702 GN=FLOT3 PE=2 SV=1
11	PDB:7vhpG	0.340	0.459	3.368E-11	299	0.103	0.147	7vhpG.pdb.gz
12	PDB:4v60A	0.367	0.211	7.805E-8	812	0.159	0.084	4v60A.pdb.gz
13	PDB:7wi3B	0.328	0.478	1.502E-6	275	0.110	0.171	7wi3B.pdb.gz
14	PDB:7pzyC	0.161	0.285	8.419E-4	214	0.028	0.056	7pzyC.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
15	PDB:7mq8NM	0.180	0.308	1.712E-3	233	0.019	0.034	7mq8NM.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:7d4iSC	0.173	0.283	4.964E-3	242	0.035	0.062	7d4iSC.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
17	PDB:4v8mA0	0.197	0.357	7.511E-3	218	0.028	0.055	4v8mA0.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
18	PDB:4v6wAB	0.189	0.338	8.969E-3	220	0.016	0.032	4v6wAB.pdb.gz	Structures of the human and Drosophila 80S ribosome.
19	PDB:4a35A	0.107	0.104	2.462E-1	441	0.026	0.025	4a35A.pdb.gz	Enzymatic and structural characterization of rTS gamma provides insights into the function of rTS beta.
20	PDB:1a8rA	0.142	0.251	3.309E-1	221	0.030	0.059	1a8rA.pdb.gz	Biosynthesis of pteridines. Reaction mechanism of GTP cyclohydrolase I.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B5X3E3	0.0	706	426	0.787	0.789	B5X3E3_SALSA Flotillin OS=Salmo salar OX=8030 GN=FLOT1 PE=2 SV=1
2	C0H9R4	0.0	706	426	0.789	0.791	C0H9R4_SALSA Flotillin OS=Salmo salar OX=8030 GN=FLOT1 PE=2 SV=1
3	O08917	0.0	847	428	0.984	0.981	FLOT1_MOUSE Flotillin-1 OS=Mus musculus OX=10090 GN=Flot1 PE=1 SV=1
4	O13127	0.0	717	423	0.789	0.797	FLOT1_CARAU Flotillin-1 OS=Carassius auratus OX=7957 GN=flot1 PE=1 SV=1
5	O61491	0.0	548	426	0.639	0.641	FLOT1_DROME Flotillin-1 OS=Drosophila melanogaster OX=7227 GN=Flo1 PE=2 SV=1
6	O75955	0.0	865	427	1.000	1.000	FLOT1_HUMAN Flotillin-1 OS=Homo sapiens OX=9606 GN=FLOT1 PE=1 SV=3
7	Q53HQ0	0.0	857	427	0.993	0.993	Q53HQ0_HUMAN Flotillin (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
8	Q5ST80	0.0	865	427	1.000	1.000	Q5ST80_HUMAN Flotillin OS=Homo sapiens OX=9606 GN=FLOT1 PE=2 SV=1
9	Q6IB58	0.0	863	427	0.998	0.998	Q6IB58_HUMAN Flotillin OS=Homo sapiens OX=9606 GN=FLOT1 PE=2 SV=1
10	Q6P2A7	0.0	847	428	0.984	0.981	Q6P2A7_RAT Flotillin OS=Rattus norvegicus OX=10116 PE=2 SV=1
11	Q767L6	0.0	856	427	0.991	0.991	FLOT1_PIG Flotillin-1 OS=Sus scrofa OX=9823 GN=FLOT1 PE=3 SV=1
12	Q9Z1E1	0.0	847	428	0.981	0.979	FLOT1_RAT Flotillin-1 OS=Rattus norvegicus OX=10116 GN=Flot1 PE=2 SV=2
13	W5ULK7	0.0	707	425	0.794	0.798	W5ULK7_ICTPU Flotillin OS=Ictalurus punctatus OX=7998 GN=flot1 PE=2 SV=1
14	Q98TZ8	7.93e-132	388	428	0.471	0.470	FLOT2_DANRE Flotillin-2a OS=Danio rerio OX=7955 GN=flot2a PE=2 SV=2
15	Q60634	1.08e-129	382	428	0.468	0.467	FLOT2_MOUSE Flotillin-2 OS=Mus musculus OX=10090 GN=Flot2 PE=1 SV=2
16	Q9Z2S9	1.08e-129	382	428	0.468	0.467	FLOT2_RAT Flotillin-2 OS=Rattus norvegicus OX=10116 GN=Flot2 PE=1 SV=1
17	J3QLD9	1.52e-129	382	428	0.461	0.460	J3QLD9_HUMAN Flotillin OS=Homo sapiens OX=9606 GN=FLOT2 PE=1 SV=1
18	Q14254	3.62e-129	381	428	0.466	0.465	FLOT2_HUMAN Flotillin-2 OS=Homo sapiens OX=9606 GN=FLOT2 PE=1 SV=2
19	Q9BTI6	1.37e-118	352	385	0.424	0.470	Q9BTI6_HUMAN Flotillin OS=Homo sapiens OX=9606 GN=FLOT2 PE=1 SV=1
20	E7EMK3	3.21e-118	355	483	0.466	0.412	E7EMK3_HUMAN Flotillin OS=Homo sapiens OX=9606 GN=FLOT2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01145 Band_7	1.5e-18	78.9	SPFH domain / Band 7 family
2	PF15975 Flot	0.043	25.3	Flotillin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365569

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378368	0.993	Flotillin-2
2	9606.ENSP00000298352	0.991	Neuroglobin
3	9606.ENSP00000360293	0.970	Sorbin and SH3 domain-containing protein 1
4	9606.ENSP00000339191	0.928	Caveolin-1
5	9606.ENSP00000261769	0.927	Cadherin-1
6	9606.ENSP00000270349	0.927	Sodium-dependent dopamine transporter
7	9606.ENSP00000284981	0.910	Amyloid-beta A4 protein
8	9606.ENSP00000375717	0.907	Prostate tumor-overexpressed gene 1 protein
9	9606.ENSP00000251849	0.898	RAF proto-oncogene serine/threonine-protein kinase
10	9606.ENSP00000348128	0.868	Supervillin
11	9606.ENSP00000269571	0.830	Receptor tyrosine-protein kinase erbB-2
12	9606.ENSP00000264033	0.804	E3 ubiquitin-protein ligase CBL
13	9606.ENSP00000251968	0.789	Tumor susceptibility gene 101 protein
14	9606.ENSP00000466989	0.782	Leucine-rich repeat and fibronectin type-III domain-containing protein 3
15	9606.ENSP00000447730	0.778	CD63 antigen
16	9606.ENSP00000363868	0.774	ATP-binding cassette sub-family A member 1
17	9606.ENSP00000355607	0.764	Glyceronephosphate O-acyltransferase
18	9606.ENSP00000394496	0.748	Coronin-1C
19	9606.ENSP00000264638	0.728	Contactin-associated protein 1
20	9606.ENSP00000345192	0.727	Noelin-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.659	enzyme binding
GO:0002020	0.449	protease binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050794	0.994	regulation of cellular process
GO:0050896	0.993	response to stimulus
GO:0051179	0.987	localization
GO:0033036	0.982	macromolecule localization
GO:0016043	0.977	cellular component organization
GO:0048856	0.951	anatomical structure development
GO:0032501	0.942	multicellular organismal process
GO:0048518	0.915	positive regulation of biological process
GO:0051641	0.896	cellular localization
GO:0048522	0.896	positive regulation of cellular process
GO:0070727	0.854	cellular macromolecule localization
GO:0051716	0.798	cellular response to stimulus
GO:0051234	0.792	establishment of localization
GO:0030154	0.755	cell differentiation
GO:0007275	0.747	multicellular organism development
GO:0006810	0.738	transport
GO:0048731	0.702	system development
GO:0051128	0.697	regulation of cellular component organization
GO:0048583	0.685	regulation of response to stimulus
GO:0032879	0.681	regulation of localization
GO:0009966	0.679	regulation of signal transduction
GO:0065009	0.666	regulation of molecular function
GO:0051050	0.660	positive regulation of transport
GO:0044087	0.659	regulation of cellular component biogenesis
GO:0044093	0.647	positive regulation of molecular function
GO:0023052	0.615	signaling
GO:0007154	0.615	cell communication
GO:0023056	0.613	positive regulation of signaling
GO:0008104	0.602	protein localization
GO:0030030	0.601	cell projection organization
GO:0019222	0.597	regulation of metabolic process
GO:0007165	0.590	signal transduction
GO:0042221	0.553	response to chemical
GO:0010647	0.553	positive regulation of cell communication
GO:0007399	0.549	nervous system development
GO:0048468	0.509	cell development
GO:0009653	0.503	anatomical structure morphogenesis
GO:0022008	0.499	neurogenesis
GO:0120036	0.492	plasma membrane bounded cell projection organization
GO:0060255	0.478	regulation of macromolecule metabolic process
GO:0000902	0.478	cell morphogenesis
GO:0048666	0.466	neuron development
GO:0080090	0.460	regulation of primary metabolic process
GO:0031323	0.458	regulation of cellular metabolic process
GO:0051171	0.454	regulation of nitrogen compound metabolic process
GO:0032990	0.415	cell part morphogenesis
GO:0030155	0.413	regulation of cell adhesion
GO:0060627	0.411	regulation of vesicle-mediated transport
GO:0048519	0.409	negative regulation of biological process
GO:0050793	0.405	regulation of developmental process
GO:0048667	0.405	cell morphogenesis involved in neuron differentiation
GO:0031175	0.405	neuron projection development
GO:0045785	0.400	positive regulation of cell adhesion
GO:0051668	0.397	localization within membrane
GO:0072657	0.394	protein localization to membrane
GO:0051130	0.385	positive regulation of cellular component organization
GO:0010468	0.383	regulation of gene expression
GO:0022407	0.356	regulation of cell-cell adhesion
GO:0008152	0.344	metabolic process
GO:0044089	0.337	positive regulation of cellular component biogenesis
GO:0048584	0.315	positive regulation of response to stimulus
GO:0009889	0.312	regulation of biosynthetic process
GO:0048812	0.305	neuron projection morphogenesis
GO:0071704	0.301	organic substance metabolic process
GO:1902531	0.300	regulation of intracellular signal transduction
GO:0007409	0.300	axonogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.997	cytoplasm
GO:0005886	0.997	plasma membrane
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0031982	0.994	vesicle
GO:0031090	0.992	organelle membrane
GO:0005576	0.989	extracellular region
GO:0098588	0.978	bounding membrane of organelle
GO:0032991	0.971	protein-containing complex
GO:0005764	0.971	lysosome
GO:0012505	0.963	endomembrane system
GO:0070062	0.954	extracellular exosome
GO:0098857	0.915	membrane microdomain
GO:0098590	0.897	plasma membrane region
GO:0097708	0.817	intracellular vesicle
GO:0031410	0.808	cytoplasmic vesicle
GO:0005774	0.778	vacuolar membrane
GO:0030054	0.770	cell junction
GO:0005765	0.766	lysosomal membrane
GO:0005829	0.705	cytosol
GO:0098796	0.691	membrane protein complex
GO:0045121	0.526	membrane raft
GO:0005901	0.437	caveola
GO:0031981	0.346	nuclear lumen
GO:0030659	0.314	cytoplasmic vesicle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]