StarFunc result for job id O75962

User Input

>input (1400 residues)
MSGSSGGAAAPAASSGPAAAASAAGSGCGGGAGEGAEEAAKDLADIAAFFRSGFRKNDEM
KAMDVLPILKEKVAYLSGGRDKRGGPILTFPARSNHDRIRQEDLRRLISYLACIPSEEVC
KRGFTVIVDMRGSKWDSIKPLLKILQESFPCCIHVALIIKPDNFWQKQRTNFGSSKFEFE
TNMVSLEGLTKVVDPSQLTPEFDGCLEYNHEEWIEIRVAFEDYISNATHMLSRLEELQDI
LAKKELPQDLEGARNMIEEHSQLKKKVIKAPIEDLDLEGQKLLQRIQSSESFPKKNSGSG
NADLQNLLPKVSTMLDRLHSTRQHLHQMWHVRKLKLDQCFQLRLFEQDAEKMFDWITHNK
GLFLNSYTEIGTSHPHAMELQTQHNHFAMNCMNVYVNINRIMSVANRLVESGHYASQQIR
QIASQLEQEWKAFAAALDERSTLLDMSSIFHQKAEKYMSNVDSWCKACGEVDLPSELQDL
EDAIHHHQGIYEHITLAYSEVSQDGKSLLDKLQRPLTPGSSDSLTASANYSKAVHHVLDV
IHEVLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKSL
HRARALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYQAAHQLEDRIQDFV
RRVEQRKILLDMSVSFHTHVKELWTWLEELQKELLDDVYAESVEAVQDLIKRFGQQQQTT
LQVTVNVIKEGEDLIQQLRDSAISSNKTPHNSSINHIETVLQQLDEAQSQMEELFQERKI
KLELFLQLRIFERDAIDIISDLESWNDELSQQMNDFDTEDLTIAEQRLQHHADKALTMNN
LTFDVIHQGQDLLQYVNEVQASGVELLCDRDVDMATRVQDLLEFLHEKQQELDLAAEQHR
KHLEQCVQLRHLQAEVKQVLGWIRNGESMLNAGLITASSLQEAEQLQREHEQFQHAIEKT
HQSALQVQQKAEAMLQANHYDMDMIRDCAEKVASHWQQLMLKMEDRLKLVNASVAFYKTS
EQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPMISKHLEQKEAFLKACTLARRN
ADVFLKYLHRNSVNMPGMVTHIKAPEQQVKNILNELFQRENRVLHYWTMRKRRLDQCQQY
VVFERSAKQALEWIHDNGEFYLSTHTSTGSSIQHTQELLKEHEEFQITAKQTKERVKLLI
QLADGFCEKGHAHAAEIKKCVTAVDKRYRDFSLRMEKYRTSLEKALGISSDSNKSSKSLQ
LDIIPASIPGSEVKLRDAAHELNEEKRKSARRKEFIMAELIQTEKAYVRDLRECMDTYLW
EMTSGVEEIPPGIVNKELIIFGNMQEIYEFHNNIFLKELEKYEQLPEDVGHCFVTWADKF
QMYVTYCKNKPDSTQLILEH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4I9W4	0.344	0.299	0.000	1632	0.729	0.625	A0A0R4I9W4.pdb.gz
2	AFDB:A0A2R8RHL8	0.419	0.266	0.000	2306	0.667	0.405	A0A2R8RHL8.pdb.gz	A0A2R8RHL8_DANRE Kalirin RhoGEF kinase b OS=Danio rerio OX=7955 GN=wu:fc60a10 PE=4 SV=1
3	AFDB:Q7KVD1	0.332	0.227	2.439E-80	2263	0.468	0.289	Q7KVD1.pdb.gz	Q7KVD1_DROME Trio, isoform A OS=Drosophila melanogaster OX=7227 GN=trio PE=1 SV=1
4	AFDB:O61528	0.337	0.211	7.484E-53	2488	0.252	0.142	O61528.pdb.gz	O61528_CAEEL CRAL-TRIO domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-73 PE=1 SV=1
5	AFDB:A0A2R8QQW1	0.275	0.442	1.310E-47	775	0.348	0.628	A0A2R8QQW1.pdb.gz
6	AFDB:Q7SX85	0.201	0.345	4.839E-24	714	0.127	0.249	Q7SX85.pdb.gz	SESD1_DANRE SEC14 domain and spectrin repeat-containing protein 1 OS=Danio rerio OX=7955 GN=sestd1 PE=2 SV=3
7	AFDB:Q86VW0	0.205	0.354	5.034E-24	696	0.119	0.239	Q86VW0.pdb.gz	SESD1_HUMAN SEC14 domain and spectrin repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=SESTD1 PE=1 SV=2
8	AFDB:O15068	0.252	0.301	8.194E-20	1137	0.107	0.132	O15068.pdb.gz	MCF2L_HUMAN Guanine nucleotide exchange factor DBS OS=Homo sapiens OX=9606 GN=MCF2L PE=1 SV=2
9	AFDB:F1R446	0.180	0.117	1.881E-19	2480	0.141	0.079	F1R446.pdb.gz
10	AFDB:Q6PDM6	0.246	0.288	2.119E-19	1166	0.106	0.128	Q6PDM6.pdb.gz	Q6PDM6_MOUSE Mcf.2 transforming sequence-like OS=Mus musculus OX=10090 GN=Mcf2l PE=1 SV=1
11	PDB:4d1eA	0.125	0.185	6.985E-4	859	0.049	0.079	4d1eA.pdb.gz
12	PDB:1sjjA	0.122	0.180	7.866E-4	863	0.049	0.079	1sjjA.pdb.gz
13	PDB:3w68C	0.105	0.479	2.792E-3	252	0.027	0.151	3w68C.pdb.gz	Impaired alpha-TTP-PIPs interaction underlies familial vitamin E deficiency
14	PDB:1oizA	0.104	0.452	3.270E-3	265	0.029	0.151	1oizA.pdb.gz	The Molecular Basis of Vitamin E Retention: Structure of Human Alpha-Tocopherol Transfer Protein
15	PDB:4cizA	0.101	0.430	3.270E-3	284	0.026	0.130	4cizA.pdb.gz	Human Cellular Retinaldehyde-Binding Protein Has Secondary Thermal 9-Cis-Retinal Isomerase Activity.
16	PDB:7sqcR1	0.050	0.039	9.522E-3	2080	0.097	0.065	7sqcR1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
17	PDB:6vaeA	0.046	0.051	1.161E-2	1198	0.098	0.114	6vaeA.pdb.gz	DNA clamp function of the monoubiquitinated Fanconi anaemia ID complex.
18	PDB:6n1zA	0.053	0.068	1.256E-2	961	0.086	0.125	6n1zA.pdb.gz
19	PDB:7mqaSP	0.045	0.032	2.186E-2	2485	0.119	0.067	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:7mp6B	0.043	0.039	2.275E-2	1609	0.100	0.087	7mp6B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8RHL8	0.0	1956	2306	0.671	0.407	A0A2R8RHL8_DANRE Kalirin RhoGEF kinase b OS=Danio rerio OX=7955 GN=wu:fc60a10 PE=4 SV=1
2	A2CG49	0.0	2199	2964	0.756	0.357	KALRN_MOUSE Kalirin OS=Mus musculus OX=10090 GN=Kalrn PE=1 SV=1
3	F1M0Z1	0.0	2901	3100	0.993	0.448	TRIO_RAT Triple functional domain protein OS=Rattus norvegicus OX=10116 GN=Trio PE=1 SV=4
4	H7BXZ5	0.0	2199	2955	0.754	0.357	H7BXZ5_HUMAN non-specific serine/threonine protein kinase (Fragment) OS=Homo sapiens OX=9606 GN=KALRN PE=1 SV=1
5	O60229	0.0	2193	2986	0.756	0.355	KALRN_HUMAN Kalirin OS=Homo sapiens OX=9606 GN=KALRN PE=1 SV=3
6	O75962	0.0	2920	3097	1.000	0.452	TRIO_HUMAN Triple functional domain protein OS=Homo sapiens OX=9606 GN=TRIO PE=1 SV=2
7	P97924	0.0	2196	2959	0.754	0.357	KALRN_RAT Kalirin OS=Rattus norvegicus OX=10116 GN=Kalrn PE=1 SV=3
8	Q0KL02	0.0	2905	3102	0.993	0.448	TRIO_MOUSE Triple functional domain protein OS=Mus musculus OX=10090 GN=Trio PE=1 SV=3
9	Q7KVD1	0.0	1256	2263	0.472	0.292	Q7KVD1_DROME Trio, isoform A OS=Drosophila melanogaster OX=7227 GN=trio PE=1 SV=1
10	Q7KY09	0.0	1251	2263	0.471	0.292	Q7KY09_DROME Trio OS=Drosophila melanogaster OX=7227 GN=trio PE=2 SV=1
11	Q9W0L0	0.0	1255	2263	0.472	0.292	Q9W0L0_DROME Guanine-nucleotide-exchange-factor TRIO OS=Drosophila melanogaster OX=7227 GN=trio PE=2 SV=3
12	Q7KPP4	1.08e-155	514	1638	0.260	0.222	Q7KPP4_CAEEL CRAL-TRIO domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-73 PE=1 SV=1
13	C4ALD5	5.92e-153	513	2140	0.260	0.170	C4ALD5_CAEEL CRAL-TRIO domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-73 PE=1 SV=1
14	O61528	6.37e-152	513	2488	0.260	0.146	O61528_CAEEL CRAL-TRIO domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-73 PE=1 SV=1
15	Q7SX85	1.15e-55	209	714	0.126	0.246	SESD1_DANRE SEC14 domain and spectrin repeat-containing protein 1 OS=Danio rerio OX=7955 GN=sestd1 PE=2 SV=3
16	Q86VW0	3.35e-54	204	696	0.121	0.244	SESD1_HUMAN SEC14 domain and spectrin repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=SESTD1 PE=1 SV=2
17	Q6PDM6	1.63e-40	166	1166	0.085	0.102	Q6PDM6_MOUSE Mcf.2 transforming sequence-like OS=Mus musculus OX=10090 GN=Mcf2l PE=1 SV=1
18	Q64096	2.24e-40	165	1149	0.085	0.104	MCF2L_MOUSE Guanine nucleotide exchange factor DBS OS=Mus musculus OX=10090 GN=Mcf2l PE=1 SV=2
19	O15068	3.26e-40	165	1137	0.086	0.106	MCF2L_HUMAN Guanine nucleotide exchange factor DBS OS=Homo sapiens OX=9606 GN=MCF2L PE=1 SV=2
20	Q63406	6.38e-40	164	1149	0.085	0.104	MCF2L_RAT Guanine nucleotide exchange factor DBS OS=Rattus norvegicus OX=10116 GN=Mcf2l PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00650 CRAL_TRIO	0.0029	28.9	CRAL/TRIO domain
2	PF13716 CRAL_TRIO_2	0.00036	32.2	Divergent CRAL/TRIO domain
3	PF12296 HsbA	43	16.0	Hydrophobic surface binding protein A
4	PF00621 RhoGEF	1.4e-15	69.5	RhoGEF domain
5	PF00435 Spectrin	4.4e-40	147.8	Spectrin repeat
6	PF15613 WSD	2.2e+02	13.8	Williams-Beuren syndrome DDT (WSD), D-TOX E motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000339299

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348461	0.990	Ras-related C3 botulinum toxin substrate 1
2	9606.ENSP00000400175	0.987	Transforming protein RhoA
3	9606.ENSP00000304283	0.954	Ras-related C3 botulinum toxin substrate 3
4	9606.ENSP00000173229	0.951	Netrin-1
5	9606.ENSP00000389140	0.951	Netrin receptor DCC
6	9606.ENSP00000286548	0.941	Guanine nucleotide-binding protein G(q) subunit alpha
7	9606.ENSP00000280333	0.923	Dedicator of cytokinesis protein 1
8	9606.ENSP00000275364	0.917	Guanine nucleotide-binding protein subunit alpha-12
9	9606.ENSP00000278568	0.915	Serine/threonine-protein kinase PAK 1
10	9606.ENSP00000400717	0.915	Guanine nucleotide-binding protein subunit alpha-13
11	9606.ENSP00000417273	0.915	Cytoplasmic protein NCK1
12	9606.ENSP00000371897	0.905	Rho GTPase-activating protein 5
13	9606.ENSP00000481878	0.902	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
14	9606.ENSP00000248572	0.900	Guanine nucleotide-binding protein G(T) subunit gamma-T1
15	9606.ENSP00000383118	0.878	Cell division control protein 42 homolog
16	9606.ENSP00000353030	0.829	Receptor-type tyrosine-protein phosphatase F
17	9606.ENSP00000249071	0.797	Ras-related C3 botulinum toxin substrate 2
18	9606.ENSP00000433361	0.727	Transmembrane protein 9B
19	9606.ENSP00000078429	0.725	Guanine nucleotide-binding protein subunit alpha-11
20	9606.ENSP00000425394	0.721	Actin-binding LIM protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0019899	0.997	enzyme binding
GO:0003824	0.840	catalytic activity
GO:0016740	0.778	transferase activity
GO:0140096	0.632	catalytic activity, acting on a protein
GO:0016772	0.587	transferase activity, transferring phosphorus-containing groups
GO:0016301	0.549	kinase activity
GO:0016773	0.517	phosphotransferase activity, alcohol group as acceptor

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0009987	0.915	cellular process
GO:0023051	0.654	regulation of signaling
GO:0010646	0.654	regulation of cell communication
GO:0032502	0.460	developmental process
GO:0048856	0.451	anatomical structure development
GO:0050896	0.360	response to stimulus
GO:0071840	0.327	cellular component organization or biogenesis
GO:0030154	0.305	cell differentiation
GO:0048583	0.300	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0005829	0.985	cytosol
GO:0043231	0.985	intracellular membrane-bounded organelle
GO:0030054	0.982	cell junction
GO:0016020	0.891	membrane
GO:0045202	0.853	synapse
GO:0005634	0.818	nucleus
GO:0071944	0.773	cell periphery
GO:0005576	0.767	extracellular region
GO:0005886	0.761	plasma membrane
GO:0098793	0.744	presynapse
GO:0098978	0.724	glutamatergic synapse
GO:0031974	0.675	membrane-enclosed lumen
GO:0031981	0.621	nuclear lumen
GO:0031982	0.589	vesicle
GO:0005654	0.462	nucleoplasm
GO:0120025	0.327	plasma membrane bounded cell projection
GO:0098794	0.326	postsynapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.778	Transferases.
EC:2.7.-.-	0.587	Transferring phosphorus-containing groups.
EC:2.7.1.-	0.517	Phosphotransferases with an alcohol group as acceptor.

[back to server]