StarFunc result for job id O75964

User Input

>input (103 residues)
MAQFVRNLVEKTPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPRAIQSLKKIVNSA
QTGSFKQLTVKEAVLNGLVATEVLMWFYVGEIIGKRGIIGYDV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75964	1.000	1.000	1.326E-15	103	1.000	1.000	O75964.pdb.gz	ATP5L_HUMAN ATP synthase subunit g, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MG PE=1 SV=3
2	AFDB:Q6PDU7	0.995	0.995	1.360E-13	103	0.786	0.786	Q6PDU7.pdb.gz	ATP5L_RAT ATP synthase subunit g, mitochondrial OS=Rattus norvegicus OX=10116 GN=Atp5mg PE=1 SV=2
3	AFDB:Q7Z4Y8	0.948	0.976	1.781E-12	100	0.864	0.890	Q7Z4Y8.pdb.gz	AT5L2_HUMAN Putative ATP synthase subunit g 2, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MGL PE=5 SV=1
4	PDB:6zbbg	0.733	0.947	5.994E-10	79	0.709	0.924	6zbbg.pdb.gz	Structure of the dimeric ATP synthase from bovine mitochondria.
5	AFDB:E9PN17	0.407	0.542	3.134E-8	76	0.689	0.934	E9PN17.pdb.gz	E9PN17_HUMAN ATP synthase membrane subunit g OS=Homo sapiens OX=9606 GN=ATP5MG PE=1 SV=2
6	AFDB:Q18803	0.778	0.620	2.517E-5	131	0.340	0.267	Q18803.pdb.gz	ATPL2_CAEEL Probable ATP synthase subunit g 2, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=asg-2 PE=3 SV=1
7	AFDB:Q12233	0.789	0.717	1.301E-2	115	0.291	0.261	Q12233.pdb.gz	ATPN_YEAST ATP synthase subunit g, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATP20 PE=1 SV=1
8	AFDB:Q9STR3	0.541	0.470	1.583E-1	122	0.243	0.205	Q9STR3.pdb.gz	Q9STR3_ARATH Copia-like retroelement pol polyprotein OS=Arabidopsis thaliana OX=3702 GN=At4g26210 PE=1 SV=1
9	AFDB:O82209	0.525	0.457	1.973E-1	122	0.252	0.213	O82209.pdb.gz	O82209_ARATH Copia-like retroelement pol polyprotein OS=Arabidopsis thaliana OX=3702 GN=At2g19680 PE=1 SV=1
10	AFDB:Q9M0D5	0.539	0.470	2.850E-1	122	0.233	0.197	Q9M0D5.pdb.gz	Q9M0D5_ARATH AT4g29480/F17A13_300 OS=Arabidopsis thaliana OX=3702 GN=At4g29480 PE=1 SV=1
11	PDB:1xq8A	0.267	0.209	2.098	140	0.194	0.143	1xq8A.pdb.gz
12	PDB:4v6wCC	0.233	0.072	4.376	392	0.087	0.023	4v6wCC.pdb.gz	Structures of the human and Drosophila 80S ribosome.
13	AFDB:P01272	0.281	0.169	9.017	180	0.117	0.067	P01272.pdb.gz	GLUC_BOVIN Pro-glucagon OS=Bos taurus OX=9913 GN=GCG PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75964	4.45e-71	208	103	1.000	1.000	ATP5L_HUMAN ATP synthase subunit g, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MG PE=1 SV=3
2	Q28852	8.54e-66	195	103	0.922	0.922	ATP5L_BOVIN ATP synthase subunit g, mitochondrial OS=Bos taurus OX=9913 GN=ATP5MG PE=1 SV=3
3	Q9CPQ8	1.28e-60	182	103	0.825	0.825	ATP5L_MOUSE ATP synthase subunit g, mitochondrial OS=Mus musculus OX=10090 GN=Atp5mg PE=1 SV=1
4	Q7Z4Y8	9.53e-59	177	100	0.864	0.890	AT5L2_HUMAN Putative ATP synthase subunit g 2, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MGL PE=5 SV=1
5	Q6PDU7	2.11e-58	176	103	0.786	0.786	ATP5L_RAT ATP synthase subunit g, mitochondrial OS=Rattus norvegicus OX=10116 GN=Atp5mg PE=1 SV=2
6	A0A3B3ITX4	6.21e-46	144	91	0.689	0.780	A0A3B3ITX4_HUMAN ATP synthase subunit O, mitochondrial OS=Homo sapiens OX=9606 PE=3 SV=1
7	Q18803	1.23e-12	61.2	131	0.340	0.267	ATPL2_CAEEL Probable ATP synthase subunit g 2, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=asg-2 PE=3 SV=1
8	E9PN17	2.53e-04	38.5	71	0.165	0.239	E9PN17_HUMAN ATP synthase membrane subunit g OS=Homo sapiens OX=9606 GN=ATP5MG PE=1 SV=2
9	Q12233	0.012	35.0	115	0.291	0.261	ATPN_YEAST ATP synthase subunit g, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATP20 PE=1 SV=1
10	Q59M30	0.016	34.7	114	0.301	0.272	Q59M30_CANAL F1F0 ATP synthase subunit g OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ATP20 PE=3 SV=1
11	O82209	0.14	32.0	122	0.175	0.148	O82209_ARATH Copia-like retroelement pol polyprotein OS=Arabidopsis thaliana OX=3702 GN=At2g19680 PE=1 SV=1
12	Q9STR3	0.66	30.4	122	0.194	0.164	Q9STR3_ARATH Copia-like retroelement pol polyprotein OS=Arabidopsis thaliana OX=3702 GN=At4g26210 PE=1 SV=1
13	Q9M0D5	1.3	29.3	122	0.223	0.189	Q9M0D5_ARATH AT4g29480/F17A13_300 OS=Arabidopsis thaliana OX=3702 GN=At4g29480 PE=1 SV=1
14	Q8R3B1	2.8	29.3	756	0.107	0.015	PLCD1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Mus musculus OX=10090 GN=Plcd1 PE=1 SV=2
15	Q9C0X8	3.0	28.9	1163	0.204	0.018	RRP12_SCHPO Putative ribosomal RNA-processing protein 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rrp12 PE=3 SV=1
16	J7QM75	3.2	28.9	241	0.107	0.046	J7QM75_ECOLX Small ribosomal subunit protein uS2 OS=Escherichia coli OX=562 GN=rpsB PE=3 SV=1
17	P0A7V0	4.0	28.5	241	0.107	0.046	RS2_ECOLI Small ribosomal subunit protein uS2 OS=Escherichia coli (strain K12) OX=83333 GN=rpsB PE=1 SV=2
18	A8VZX9	8.2	27.7	1769	0.155	0.009	A8VZX9_AGRRH Rcorf28 OS=Agrobacterium rhizogenes OX=359 PE=1 SV=1
19	A0A0G2JW60	9.4	27.7	3424	0.175	0.005	A0A0G2JW60_RAT Utrophin OS=Rattus norvegicus OX=10116 GN=Utrn PE=1 SV=1
20	G3V7L1	9.4	27.7	3419	0.175	0.005	UTRN_RAT Utrophin OS=Rattus norvegicus OX=10116 GN=Utrn PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04718 ATP-synt_G	1.8e-23	94.6	Mitochondrial ATP synthase g subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000008982

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000004835	0.999	ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1
2	61853.ENSNLEP00000001037	0.994	ATP synthase, H+ transporting, mitochondrial Fo complex, subunit E
3	61853.ENSNLEP00000000662	0.993	ATP synthase subunit d, mitochondrial
4	61853.ENSNLEP00000001688	0.993	Uncharacterized protein
5	61853.ENSNLEP00000005120	0.993	Uncharacterized protein
6	61853.ENSNLEP00000014516	0.990	ATP synthase, H+ transporting, mitochondrial F1 complex, gamma polypeptide 1
7	61853.ENSNLEP00000002932	0.988	ATP synthase-coupling factor 6, mitochondrial
8	61853.ENSNLEP00000021189	0.985	ATP synthase subunit beta
9	61853.ENSNLEP00000013500	0.983	ATP synthase, H+ transporting, mitochondrial Fo complex, subunit F2
10	61853.ENSNLEP00000013617	0.981	ATP synthase subunit alpha
11	61853.ENSNLEP00000022535	0.981	Uncharacterized protein
12	61853.ENSNLEP00000018512	0.980	Uncharacterized protein
13	61853.ENSNLEP00000016627	0.953	NADH:ubiquinone oxidoreductase subunit B7
14	61853.ENSNLEP00000023870	0.953	NADH dehydrogenase [ubiquinone] 1 subunit C2
15	61853.ENSNLEP00000022118	0.947	NADH:ubiquinone oxidoreductase subunit A5
16	61853.ENSNLEP00000020044	0.946	Cytochrome b-c1 complex subunit 6
17	61853.ENSNLEP00000015621	0.943	Ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa
18	61853.ENSNLEP00000001649	0.939	Chromosome 17 open reading frame 80
19	61853.ENSNLEP00000013438	0.938	NADH:ubiquinone oxidoreductase subunit S4
20	61853.ENSNLEP00000023807	0.927	ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C3 (subunit 9)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0046933	1.000	proton-transporting ATP synthase activity, rotational mechanism

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.996	cellular metabolic process
GO:0044238	0.993	primary metabolic process
GO:1901564	0.990	organonitrogen compound metabolic process
GO:0034641	0.989	cellular nitrogen compound metabolic process
GO:0006754	0.979	ATP biosynthetic process
GO:0015986	0.962	proton motive force-driven ATP synthesis
GO:0009060	0.940	aerobic respiration
GO:0006119	0.913	oxidative phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1902494	0.999	catalytic complex
GO:0098800	0.997	inner mitochondrial membrane protein complex
GO:0016469	0.987	proton-transporting two-sector ATPase complex
GO:0005753	0.983	mitochondrial proton-transporting ATP synthase complex
GO:0000276	0.309	mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:57720	1.000	ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate
EC:7.1.2.2	1.000	H(+)-transporting two-sector ATPase.

[back to server]