StarFunc result for job id O75970

User Input

>input (2070 residues)
MLEAIDKNRALHAAERLQTKLRERGDVANEDKLSLLKSVLQSPLFSQILSLQTSVQQLKD
QVNIATSATSNIEYAHVPHLSPAVIPTLQNESFLLSPNNGNLEALTGPGIPHINGKPACD
EFDQLIKNMAQGRHVEVFELLKPPSGGLGFSVVGLRSENRGELGIFVQEIQEGSVAHRDG
RLKETDQILAINGQALDQTITHQQAISILQKAKDTVQLVIARGSLPQLVSPIVSRSPSAA
STISAHSNPVHWQHMETIELVNDGSGLGFGIIGGKATGVIVKTILPGGVADQHGRLCSGD
HILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAIEERTAPTALGITLSSSPTSTPE
LRVDASTQKGEESETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDG
RIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGMKQEAELMSREDVTKDA
DLSPVNASIIKENYEKDEDFLSSTRNTNILPTEEEGYPLLSAEIEEIEDAQKQEAALLTK
WQRIMGINYEIVVAHVSKFSENSGLGISLEATVGHHFIRSVLPEGPVGHSGKLFSGDELL
EVNGITLLGENHQDVVNILKELPIEVTMVCCRRTVPPTTQSELDSLDLCDIELTEKPHVD
LGEFIGSSETEDPVLAMTDAGQSTEEVQAPLAMWEAGIQHIELEKGSKGLGFSILDYQDP
IDPASTVIIIRSLVPGGIAEKDGRLLPGDRLMFVNDVNLENSSLEEAVEALKGAPSGTVR
IGVAKPLPLSPEEGYVSAKEDSFLYPPHSCEEAGLADKPLFRADLALVGTNDADLVDEST
FESPYSPENDSIYSTQASILSLHGSSCGDGLNYGSSLPSSPPKDVIENSCDPVLDLHMSL
EELYTQNLLQRQDENTPSVDISMGPASGFTINDYTPANAIEQQYECENTIVWTESHLPSE
VISSAELPSVLPDSAGKGSEYLLEQSSLACNAECVMLQNVSKESFERTINIAKGNSSLGM
TVSANKDGLGMIVRSIIHGGAISRDGRIAIGDCILSINEESTISVTNAQARAMLRRHSLI
GPDIKITYVPAEHLEEFKISLGQQSGRVMALDIFSSYTGRDIPELPEREEGEGEESELQN
TAYSNWNQPRRVELWREPSKSLGISIVGGRGMGSRLSNGEVMRGIFIKHVLEDSPAGKNG
TLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIINRPRKSPLPSLLHNLYP
KYNFSSTNPFADSLQINADKAPSQSESEPEKAPLCSVPPPPPSAFAEMGSDHTQSSASKI
SQDVDKEDEFGYSWKNIRERYGTLTGELHMIELEKGHSGLGLSLAGNKDRSRMSVFIVGI
DPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIRNKDAVNQMA
VCPGNAVEPLPSNSENLQNKETEPTVTTSDAAVDLSSFKNVQHLELPKDQGGLGIAISEE
DTLSGVIIKSLTEHGVAATDGRLKVGDQILAVDDEIVVGYPIEKFISLLKTAKMTVKLTI
HAENPDSQAVPSAAGAASGEKKNSSQSLMVPQSGSPEPESIRNTSRSSTPAIFASDPATC
PIIPGCETTIEISKGRTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEV
NGIDLRKATHDEAINVLRQTPQRVRLTLYRDEAPYKEEEVCDTLTIELQKKPGKGLGLSI
VGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLKCSLGTVT
LEVGRIKAGPFHSERRPSQSSQVSEGSLSSFTFPLSGSSTSESLESSSKKNALASEIQGL
RTVEMKKGPTDSLGISIAGGVGSPLGDVPIFIAMMHPTGVAAQTQKLRVGDRIVTICGTS
TEGMTHTQAVNLLKNASGSIEMQVVAGGDVSVVTGHQQEPASSSLSFTGLTSSSIFQDDL
GPPQCKSITLERGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAV
NGQSLEGVTHEEAVAILKRTKGTVTLMVLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E2QYC9	0.127	0.138	0.000	1828	0.390	0.441	E2QYC9.pdb.gz	INADL_CANLF InaD-like protein OS=Canis lupus familiaris OX=9615 GN=PATJ PE=1 SV=3
2	AFDB:F1MAD2	0.172	0.187	0.000	1836	0.384	0.433	F1MAD2.pdb.gz	INADL_RAT InaD-like protein OS=Rattus norvegicus OX=10116 GN=Patj PE=1 SV=2
3	AFDB:O75970	1.000	1.000	0.000	2070	1.000	1.000	O75970.pdb.gz	MPDZ_HUMAN Multiple PDZ domain protein OS=Homo sapiens OX=9606 GN=MPDZ PE=1 SV=2
4	AFDB:Q8NI35	0.197	0.209	0.000	1801	0.375	0.431	Q8NI35.pdb.gz	INADL_HUMAN InaD-like protein OS=Homo sapiens OX=9606 GN=PATJ PE=1 SV=3
5	AFDB:Q8VBX6	0.377	0.379	0.000	2055	0.842	0.848	Q8VBX6.pdb.gz	MPDZ_MOUSE Multiple PDZ domain protein OS=Mus musculus OX=10090 GN=Mpdz PE=1 SV=2
6	AFDB:F1Q897	0.078	0.103	3.263E-37	1503	0.114	0.157	F1Q897.pdb.gz	F1Q897_DANRE Membrane-associated guanylate kinase, WW and PDZ domain-containing 2a OS=Danio rerio OX=7955 GN=fb82g11 PE=4 SV=3
7	AFDB:Q9EQJ9	0.085	0.111	2.466E-33	1476	0.114	0.161	Q9EQJ9.pdb.gz	MAGI3_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Mus musculus OX=10090 GN=Magi3 PE=1 SV=2
8	AFDB:Q9VKG8	0.069	0.073	1.313E-24	1916	0.125	0.135	Q9VKG8.pdb.gz	Q9VKG8_DROME Discs large 5, isoform A OS=Drosophila melanogaster OX=7227 GN=Dlg5 PE=1 SV=1
9	AFDB:E9Q9R9	0.068	0.072	2.073E-24	1921	0.110	0.118	E9Q9R9.pdb.gz	DLG5_MOUSE Disks large homolog 5 OS=Mus musculus OX=10090 GN=Dlg5 PE=1 SV=1
10	PDB:2xkxA	0.077	0.198	1.460E-17	721	0.060	0.172	2xkxA.pdb.gz
11	AFDB:P39447	0.059	0.066	3.105E-16	1745	0.125	0.148	P39447.pdb.gz	ZO1_MOUSE Tight junction protein ZO-1 OS=Mus musculus OX=10090 GN=Tjp1 PE=1 SV=2
12	PDB:7pc3A	0.042	0.209	7.483E-7	405	0.020	0.101	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
13	PDB:7p73A	0.042	0.205	2.172E-6	420	0.018	0.088	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
14	PDB:7p70A	0.043	0.213	3.795E-6	407	0.016	0.084	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
15	PDB:5n7dA	0.042	0.195	3.993E-6	423	0.014	0.069	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
16	PDB:7qqmA	0.040	0.197	3.363E-5	413	0.014	0.073	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
17	PDB:7pcbA	0.042	0.202	4.560E-5	415	0.010	0.051	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
18	PDB:6pcvA	0.037	0.096	5.047E-5	754	0.019	0.053	6pcvA.pdb.gz
19	PDB:3pv2B	0.048	0.180	5.586E-5	388	0.026	0.137	3pv2B.pdb.gz
20	PDB:7pc5A	0.039	0.188	1.324E-4	405	0.014	0.072	7pc5A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E2QYC9	0.0	707	1828	0.197	0.223	INADL_CANLF InaD-like protein OS=Canis lupus familiaris OX=9615 GN=PATJ PE=1 SV=3
2	F1MAD2	0.0	693	1836	0.198	0.223	INADL_RAT InaD-like protein OS=Rattus norvegicus OX=10116 GN=Patj PE=1 SV=2
3	O55164	0.0	3437	2054	0.848	0.855	MPDZ_RAT Multiple PDZ domain protein OS=Rattus norvegicus OX=10116 GN=Mpdz PE=1 SV=1
4	O75970	0.0	4214	2070	1.000	1.000	MPDZ_HUMAN Multiple PDZ domain protein OS=Homo sapiens OX=9606 GN=MPDZ PE=1 SV=2
5	Q8VBX6	0.0	3410	2055	0.842	0.848	MPDZ_MOUSE Multiple PDZ domain protein OS=Mus musculus OX=10090 GN=Mpdz PE=1 SV=2
6	A0A2R8Y549	6.98e-173	580	1882	0.171	0.188	A0A2R8Y549_HUMAN PATJ crumbs cell polarity complex component OS=Homo sapiens OX=9606 GN=PATJ PE=1 SV=1
7	A5PKX9	1.68e-170	556	1181	0.170	0.297	A5PKX9_HUMAN INADL protein OS=Homo sapiens OX=9606 GN=INADL PE=1 SV=1
8	Q63ZW7	1.23e-166	561	1834	0.167	0.188	INADL_MOUSE InaD-like protein OS=Mus musculus OX=10090 GN=Patj PE=1 SV=2
9	Q8NI35	2.09e-165	557	1801	0.170	0.195	INADL_HUMAN InaD-like protein OS=Homo sapiens OX=9606 GN=PATJ PE=1 SV=3
10	Q9NB04	4.59e-68	251	871	0.068	0.161	PATJ_DROME Patj homolog OS=Drosophila melanogaster OX=7227 GN=Patj PE=1 SV=2
11	Q8N448	7.99e-62	228	690	0.075	0.226	LNX2_HUMAN Ligand of Numb protein X 2 OS=Homo sapiens OX=9606 GN=LNX2 PE=1 SV=1
12	Q91XL2	1.01e-60	225	687	0.075	0.227	LNX2_MOUSE Ligand of Numb protein X 2 OS=Mus musculus OX=10090 GN=Lnx2 PE=1 SV=2
13	Q8TBB1	3.21e-57	215	728	0.075	0.214	LNX1_HUMAN E3 ubiquitin-protein ligase LNX OS=Homo sapiens OX=9606 GN=LNX1 PE=1 SV=1
14	F1R5N4	2.75e-56	213	737	0.075	0.210	F1R5N4_DANRE Ligand of Numb protein X 2 OS=Danio rerio OX=7955 GN=lnx2 PE=4 SV=1
15	O70263	1.23e-55	210	728	0.075	0.213	LNX1_MOUSE E3 ubiquitin-protein ligase LNX OS=Mus musculus OX=10090 GN=Lnx1 PE=1 SV=1
16	B6DRF5	2.19e-55	210	737	0.074	0.209	B6DRF5_DANRE Ligand of numb-protein X 2 OS=Danio rerio OX=7955 GN=lnx2 PE=2 SV=1
17	G5ECZ8	1.31e-54	214	2422	0.052	0.045	G5ECZ8_CAEEL PDZ domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mpz-1 PE=1 SV=2
18	A4VCF7	1.54e-50	194	678	0.072	0.220	A4VCF7_DANRE Ligand of numb-protein X 2b OS=Danio rerio OX=7955 GN=lnxL PE=1 SV=1
19	Q24008	5.71e-48	186	674	0.091	0.279	INAD_DROME Inactivation-no-after-potential D protein OS=Drosophila melanogaster OX=7227 GN=inaD PE=1 SV=2
20	C6KRJ8	5.49e-35	147	802	0.097	0.249	C6KRJ8_CAEEL Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Caenorhabditis elegans OX=6239 GN=magi-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19805 DUF6288	45	14.6	Family of unknown function (DUF6288)
2	PF09045 L27_2	8.5e-31	117.0	L27_2
3	PF16667 MPDZ_u10	1.7e-27	107.4	Unstructured region 10 on multiple PDZ protein
4	PF00595 PDZ	4.3e-188	621.5	PDZ domain
5	PF13180 PDZ_2	4.7e-56	198.4	PDZ domain
6	PF17816 PDZ_4	0.38	22.4	PDZ domain
7	PF17820 PDZ_6	2.2e-81	279.0	PDZ domain
8	PF02163 Peptidase_M50	1.3e-29	115.1	Peptidase family M50
9	PF11133 Phage_head_fibr	1.7e+02	13.0	Head fiber protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008963555.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003824112.1	0.989	Belongs to the MAGUK family.
2	9597.XP_008973809.1	0.955	Angiomotin
3	9597.XP_008952059.1	0.898	Angiomotin like 1
4	9597.XP_003822567.2	0.886	Angiomotin like 2
5	9597.XP_008973950.1	0.869	Pleckstrin homology and RhoGEF domain containing G5
6	9597.XP_003821483.1	0.812	Membrane palmitoylated protein 7
7	9597.XP_008959437.1	0.768	5-hydroxytryptamine receptor 2C-like
8	9597.XP_008969375.1	0.768	5-hydroxytryptamine receptor 2C isoform X1
9	9597.XP_003821603.1	0.765	Belongs to the G-protein coupled receptor 1 family.
10	9597.XP_008967710.1	0.739	Protocadherin Fat 4 isoform X1
11	9597.XP_008966570.1	0.724	Calcium/calmodulin dependent serine protein kinase
12	9597.XP_008974920.1	0.723	Crumbs 1, cell polarity complex component
13	9597.XP_008958875.1	0.716	ras/Rap GTPase-activating protein SynGAP isoform X1
14	9597.XP_008967798.1	0.715	Glutamate receptor ionotropic, NMDA 2B
15	9597.XP_003831969.1	0.704	Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily
16	9597.XP_008968491.1	0.694	Belongs to the adaptor complexes small subunit family.
17	9597.XP_003812415.2	0.692	Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily
18	9597.XP_008953806.1	0.692	Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily
19	9597.XP_008964521.1	0.692	Protein kinase C beta type isoform X1
20	9597.XP_003821410.1	0.661	Phospholipase C beta 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0065007	0.985	biological regulation
GO:0050794	0.978	regulation of cellular process
GO:0032501	0.960	multicellular organismal process
GO:0048856	0.924	anatomical structure development
GO:0007275	0.840	multicellular organism development
GO:0050896	0.838	response to stimulus
GO:0048731	0.787	system development
GO:0016043	0.749	cellular component organization
GO:0007399	0.588	nervous system development
GO:0051179	0.498	localization
GO:0051716	0.488	cellular response to stimulus
GO:0007154	0.468	cell communication
GO:0023052	0.467	signaling
GO:0007165	0.455	signal transduction
GO:0048518	0.382	positive regulation of biological process
GO:0048522	0.303	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043226	0.999	organelle
GO:0030054	0.999	cell junction
GO:0005737	0.999	cytoplasm
GO:0043227	0.993	membrane-bounded organelle
GO:0098590	0.988	plasma membrane region
GO:0005829	0.981	cytosol
GO:0043229	0.978	intracellular organelle
GO:0032991	0.969	protein-containing complex
GO:0043231	0.956	intracellular membrane-bounded organelle
GO:0031982	0.893	vesicle
GO:0005576	0.872	extracellular region
GO:0070161	0.855	anchoring junction
GO:0043228	0.822	non-membrane-bounded organelle
GO:0005911	0.821	cell-cell junction
GO:0043232	0.755	intracellular non-membrane-bounded organelle
GO:0005615	0.732	extracellular space
GO:0043230	0.607	extracellular organelle
GO:0045202	0.588	synapse
GO:0065010	0.577	extracellular membrane-bounded organelle
GO:1903561	0.574	extracellular vesicle
GO:0070062	0.554	extracellular exosome
GO:0045177	0.441	apical part of cell
GO:0070160	0.383	tight junction
GO:0043296	0.370	apical junction complex
GO:0005634	0.358	nucleus
GO:0005923	0.349	bicellular tight junction
GO:0016327	0.342	apicolateral plasma membrane
GO:0098796	0.341	membrane protein complex
GO:0016324	0.339	apical plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]