StarFunc result for job id O75976

User Input

>input (1380 residues)
MASGRDERPPWRLGRLLLLMCLLLLGSSARAAHIKKAEATTTTTSAGAEAAEGQFDRYYH
EEELESALREAAAAGLPGLARLFSIGRSVEGRPLWVLRLTAGLGSLIPEGDAGPDAAGPD
AAGPLLPGRPQVKLVGNMHGDETVSRQVLIYLARELAAGYRRGDPRLVRLLNTTDVYLLP
SLNPDGFERAREGDCGFGDGGPSGASGRDNSRGRDLNRSFPDQFSTGEPPALDEVPEVRA
LIEWIRRNKFVLSGNLHGGSVVASYPFDDSPEHKATGIYSKTSDDEVFKYLAKAYASNHP
IMKTGEPHCPGDEDETFKDGITNGAHWYDVEGGMQDYNYVWANCFEITLELSCCKYPPAS
QLRQEWENNRESLITLIEKVHIGVKGFVKDSITGSGLENATISVAGINHNITTGRFGDFY
RLLVPGTYNLTVVLTGYMPLTVTNVVVKEGPATEVDFSLRPTVTSVIPDTTEAVSTASTV
AIPNILSGTSSSYQPIQPKDFHHHHFPDMEIFLRRFANEYPNITRLYSLGKSVESRELYV
MEISDNPGVHEPGEPEFKYIGNMHGNEVVGRELLLNLIEYLCKNFGTDPEVTDLVHNTRI
HLMPSMNPDGYEKSQEGDSISVIGRNNSNNFDLNRNFPDQFVQITDPTQPETIAVMSWMK
SYPFVLSANLHGGSLVVNYPFDDDEQGLATYSKSPDDAVFQQIALSYSKENSQMFQGRPC
KNMYPNEYFPHGITNGASWYNVPGGMQDWNYLQTNCFEVTIELGCVKYPLEKELPNFWEQ
NRRSLIQFMKQVHQGVRGFVLDATDGRGILNATISVAEINHPVTTYKTGDYWRLLVPGTY
KITASARGYNPVTKNVTVKSEGAIQVNFTLVRSSTDSNNESKKGKGASSSTNDASDPTTK
EFETLIKDLSAENGLESLMLRSSSNLALALYRYHSYKDLSEFLRGLVMNYPHITNLTNLG
QSTEYRHIWSLEISNKPNVSEPEEPKIRFVAGIHGNAPVGTELLLALAEFLCLNYKKNPA
VTQLVDRTRIVIVPSLNPDGRERAQEKDCTSKIGQTNARGKDLDTDFTNNASQPETKAII
ENLIQKQDFSLSVALDGGSMLVTYPYDKPVQTVENKETLKHLASLYANNHPSMHMGQPSC
PNKSDENIPGGVMRGAEWHSHLGSMKDYSVTYGHCPEITVYTSCCYFPSAARLPSLWADN
KRSLLSMLVEVHKGVHGFVKDKTGKPISKAVIVLNEGIKVQTKEGGYFHVLLAPGVHNII
AIADGYQQQHSQVFVHHDAASSVVIVFDTDNRIFGLPRELVVTVSGATMSALILTACIIW
CICSIKSNRHKDGFHRLRQHHDEYEDEIRMMSTGSKKSLLSHEFQDETDTEEETLYSSKH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75976	1.000	1.000	0.000	1380	1.000	1.000	O75976.pdb.gz	CBPD_HUMAN Carboxypeptidase D OS=Homo sapiens OX=9606 GN=CPD PE=1 SV=2
2	AFDB:P42787	0.284	0.280	0.000	1406	0.322	0.317	P42787.pdb.gz	CBPD_DROME Carboxypeptidase D OS=Drosophila melanogaster OX=7227 GN=svr PE=1 SV=2
3	AFDB:Q90240	0.594	0.591	0.000	1389	0.764	0.759	Q90240.pdb.gz	CBPD_ANAPL Carboxypeptidase D OS=Anas platyrhynchos OX=8839 GN=CPD PE=1 SV=1
4	PDB:1h8lA	0.275	0.997	3.449E-67	380	0.231	0.839	1h8lA.pdb.gz	The crystal structure of the inhibitor-complexed carboxypeptidase D domain II and the modeling of regulatory carboxypeptidases.
5	AFDB:U3JB00	0.263	0.615	2.249E-49	582	0.160	0.380	U3JB00.pdb.gz
6	AFDB:P15087	0.266	0.753	9.321E-49	476	0.148	0.429	P15087.pdb.gz	CBPE_RAT Carboxypeptidase E OS=Rattus norvegicus OX=10116 GN=Cpe PE=1 SV=1
7	AFDB:Q9EQV8	0.266	0.785	1.040E-48	457	0.148	0.446	Q9EQV8.pdb.gz	CBPN_RAT Carboxypeptidase N catalytic chain OS=Rattus norvegicus OX=10116 GN=Cpn1 PE=2 SV=1
8	AFDB:P15169	0.262	0.777	2.004E-48	458	0.146	0.441	P15169.pdb.gz	CBPN_HUMAN Carboxypeptidase N catalytic chain OS=Homo sapiens OX=9606 GN=CPN1 PE=1 SV=1
9	AFDB:Q22825	0.275	0.760	8.716E-47	492	0.125	0.352	Q22825.pdb.gz	Q22825_CAEEL Peptidase M14 carboxypeptidase A domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cpd-2 PE=1 SV=3
10	PDB:2nsmA	0.260	0.900	1.132E-46	390	0.143	0.505	2nsmA.pdb.gz
11	AFDB:Q9Z100	0.262	0.493	4.255E-46	722	0.141	0.269	Q9Z100.pdb.gz	CPXM1_MOUSE Probable carboxypeptidase X1 OS=Mus musculus OX=10090 GN=Cpxm1 PE=2 SV=2
12	AFDB:P14384	0.263	0.807	2.586E-45	443	0.133	0.415	P14384.pdb.gz	CBPM_HUMAN Carboxypeptidase M OS=Homo sapiens OX=9606 GN=CPM PE=1 SV=2
13	PDB:1uwyA	0.263	0.903	2.040E-44	393	0.133	0.468	1uwyA.pdb.gz	Crystal Structure of Human Carboxypeptidase M, a Membrane-Bound Enzyme that Regulates Peptide Hormone Activity
14	PDB:1ayeA	0.175	0.573	9.928E-17	401	0.048	0.165	1ayeA.pdb.gz	The three-dimensional structure of human procarboxypeptidase A2. Deciphering the basis of the inhibition, activation and intrinsic activity of the zymogen.
15	PDB:1kwmA	0.175	0.571	4.589E-16	402	0.043	0.149	1kwmA.pdb.gz	Human procarboxypeptidase B: three-dimensional structure and implications for thrombin-activatable fibrinolysis inhibitor (TAFI).
16	PDB:5mrvA	0.174	0.736	1.036E-14	307	0.041	0.186	5mrvA.pdb.gz	Crystal structure and mechanism of human carboxypeptidase O: Insights into its specific activity for acidic residues.
17	PDB:4p10A	0.168	0.536	6.646E-14	402	0.046	0.157	4p10A.pdb.gz	Design and synthesis of conformationally restricted inhibitors of active thrombin activatable fibrinolysis inhibitor (TAFIa).
18	PDB:5hvfA	0.157	0.541	1.017E-11	372	0.036	0.132	5hvfA.pdb.gz	Elucidation of the molecular mechanisms of two nanobodies that inhibit thrombin-activatable fibrinolysis inhibitor activation and activated thrombin-activatable fibrinolysis inhibitor activity.
19	PDB:4axvA	0.126	0.631	4.641E-9	241	0.038	0.220	4axvA.pdb.gz	Mpaa is a Murein-Tripeptide-Specific Zinc Carboxypeptidase that Functions as Part of a Catabolic Pathway for Peptidoglycan Derived Peptides in Gamma-Proteobacteria.
20	PDB:1yw6A	0.114	0.417	3.088E-5	316	0.040	0.174	1yw6A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75976	0.0	2878	1380	1.000	1.000	CBPD_HUMAN Carboxypeptidase D OS=Homo sapiens OX=9606 GN=CPD PE=1 SV=2
2	P42787	0.0	708	1406	0.324	0.318	CBPD_DROME Carboxypeptidase D OS=Drosophila melanogaster OX=7227 GN=svr PE=1 SV=2
3	P83852	0.0	699	380	0.231	0.839	CBPD_LOPSP Carboxypeptidase D (Fragment) OS=Lophonetta specularioides OX=75873 GN=CPD PE=1 SV=1
4	Q90240	0.0	2098	1389	0.754	0.749	CBPD_ANAPL Carboxypeptidase D OS=Anas platyrhynchos OX=8839 GN=CPD PE=1 SV=1
5	Q9JHW1	0.0	2559	1378	0.912	0.914	CBPD_RAT Carboxypeptidase D OS=Rattus norvegicus OX=10116 GN=Cpd PE=1 SV=2
6	P16870	5.83e-123	393	476	0.146	0.424	CBPE_HUMAN Carboxypeptidase E OS=Homo sapiens OX=9606 GN=CPE PE=1 SV=1
7	P15087	9.56e-123	392	476	0.146	0.424	CBPE_RAT Carboxypeptidase E OS=Rattus norvegicus OX=10116 GN=Cpe PE=1 SV=1
8	Q6NY94	1.44e-122	390	450	0.149	0.458	Q6NY94_DANRE Carboxypeptidase N catalytic chain precursor OS=Danio rerio OX=7955 GN=fa99g08 PE=2 SV=1
9	Q00493	2.36e-122	391	476	0.146	0.422	CBPE_MOUSE Carboxypeptidase E OS=Mus musculus OX=10090 GN=Cpe PE=1 SV=2
10	Q9JJN5	3.19e-121	387	457	0.149	0.451	CBPN_MOUSE Carboxypeptidase N catalytic chain OS=Mus musculus OX=10090 GN=Cpn1 PE=1 SV=1
11	P15169	2.06e-119	382	458	0.145	0.437	CBPN_HUMAN Carboxypeptidase N catalytic chain OS=Homo sapiens OX=9606 GN=CPN1 PE=1 SV=1
12	Q9EQV8	2.43e-119	382	457	0.150	0.453	CBPN_RAT Carboxypeptidase N catalytic chain OS=Rattus norvegicus OX=10116 GN=Cpn1 PE=2 SV=1
13	P14384	6.20e-114	367	443	0.134	0.418	CBPM_HUMAN Carboxypeptidase M OS=Homo sapiens OX=9606 GN=CPM PE=1 SV=2
14	Q22825	5.27e-104	342	492	0.123	0.346	Q22825_CAEEL Peptidase M14 carboxypeptidase A domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cpd-2 PE=1 SV=3
15	Q9Z100	9.63e-102	343	722	0.143	0.274	CPXM1_MOUSE Probable carboxypeptidase X1 OS=Mus musculus OX=10090 GN=Cpxm1 PE=2 SV=2
16	O17754	1.19e-96	321	472	0.129	0.377	CBPE_CAEEL Carboxypeptidase E OS=Caenorhabditis elegans OX=6239 GN=egl-21 PE=1 SV=1
17	Q66K79	1.41e-95	324	652	0.127	0.268	CBPZ_HUMAN Carboxypeptidase Z OS=Homo sapiens OX=9606 GN=CPZ PE=1 SV=2
18	Q8R4V4	9.54e-95	322	654	0.130	0.275	CBPZ_MOUSE Carboxypeptidase Z OS=Mus musculus OX=10090 GN=Cpz PE=2 SV=2
19	Q9M9H7	4.53e-88	297	491	0.119	0.334	SOL1_ARATH Carboxypeptidase SOL1 OS=Arabidopsis thaliana OX=3702 GN=SOL1 PE=2 SV=1
20	Q640N1	1.87e-85	306	1128	0.126	0.154	AEBP1_MOUSE Adipocyte enhancer-binding protein 1 OS=Mus musculus OX=10090 GN=Aebp1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04952 AstE_AspA	1.7e-07	42.3	Succinylglutamate desuccinylase / Aspartoacylase family
2	PF13715 CarbopepD_reg_2	8.5e-16	69.1	CarboxypepD_reg-like domain
3	PF13620 CarboxypepD_reg	4.7e-35	131.1	Carboxypeptidase regulatory-like domain
4	PF14686 fn3_3	1.6e+02	13.5	Polysaccharide lyase family 4, domain II
5	PF08308 PEGA	0.001	30.3	PEGA domain
6	PF00246 Peptidase_M14	1.1e-201	680.3	Zinc carboxypeptidase
7	PF20608 Phage_tube_C	0.13	24.0	Phage tail tube protein C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000225719

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000386443	0.956	Trans-Golgi network integral membrane protein 2
2	9606.ENSP00000349437	0.950	Cation-independent mannose-6-phosphate receptor
3	9606.ENSP00000256637	0.928	Sortilin
4	9606.ENSP00000368831	0.914	Sorting nexin-2
5	9606.ENSP00000265970	0.912	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha
6	9606.ENSP00000353224	0.912	Transferrin receptor protein 1
7	9606.ENSP00000377015	0.911	Phosphatidylinositol-binding clathrin assembly protein
8	9606.ENSP00000261842	0.907	AP-4 complex subunit epsilon-1
9	9606.ENSP00000255194	0.906	AP-3 complex subunit beta-1
10	9606.ENSP00000314499	0.902	Cyclin-G-associated kinase
11	9606.ENSP00000341737	0.902	Adaptin ear-binding coat-associated protein 1
12	9606.ENSP00000360108	0.902	Putative tyrosine-protein phosphatase auxilin
13	9606.ENSP00000376024	0.902	Sorting nexin-9
14	9606.ENSP00000253083	0.901	Huntingtin-interacting protein 1-related protein
15	9606.ENSP00000325369	0.901	AP-3 complex subunit sigma-1
16	9606.ENSP00000432083	0.901	Heat shock cognate 71 kDa protein
17	9606.ENSP00000357674	0.900	SNARE-associated protein Snapin
18	9606.ENSP00000358582	0.900	AP-4 complex subunit beta-1
19	9606.ENSP00000360154	0.900	Inositol polyphosphate 5-phosphatase OCRL-1
20	9606.ENSP00000366998	0.900	Sorting nexin-5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004180	0.999	carboxypeptidase activity
GO:0005488	0.998	binding
GO:0017171	0.989	serine hydrolase activity
GO:0070008	0.968	serine-type exopeptidase activity
GO:0004185	0.845	serine-type carboxypeptidase activity
GO:0004181	0.644	metallocarboxypeptidase activity
GO:0005515	0.626	protein binding
GO:0043167	0.344	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050896	0.948	response to stimulus
GO:0051716	0.903	cellular response to stimulus
GO:0042221	0.812	response to chemical
GO:0070887	0.785	cellular response to chemical stimulus
GO:0034097	0.611	response to cytokine
GO:0065007	0.572	biological regulation
GO:0071310	0.445	cellular response to organic substance
GO:0050789	0.402	regulation of biological process
GO:0071704	0.330	organic substance metabolic process
GO:0044238	0.319	primary metabolic process
GO:0050794	0.310	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.998	endomembrane system
GO:0031982	0.997	vesicle
GO:0005737	0.996	cytoplasm
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0016020	0.992	membrane
GO:0005576	0.971	extracellular region
GO:0005794	0.958	Golgi apparatus
GO:0005634	0.952	nucleus
GO:0005886	0.946	plasma membrane
GO:0005802	0.931	trans-Golgi network
GO:0005829	0.924	cytosol
GO:0031410	0.906	cytoplasmic vesicle
GO:0070062	0.862	extracellular exosome
GO:0031090	0.854	organelle membrane
GO:0070013	0.342	intracellular organelle lumen
GO:0048471	0.332	perinuclear region of cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:28783	0.999	H2O + L-cysteinylglycine = glycine + L-cysteine
EC:3.4.16.-	0.845	Serine-type carboxypeptidases.
EC:3.4.17.-	0.644	Metallocarboxypeptidases.

[back to server]