StarFunc result for job id O75995

User Input

>input (380 residues)
MLRRKPSNASEKEPTQKKKLSLQRSSSFKDFAKSKPSSPVVSEKEFNLDDNIPEDDSGVP
TPEDAGKSGKKLGKKWRAVISRTMNRKMGKMMVKALSEEMADTLEEGSASPTSPDYSLDS
PGPEKMALAFSEQEEHELPVLSRQASTGSELCSPSPGSGSFGEEPPAPQYTGPFCGRARV
HTDFTPSPYDHDSLKLQKGDVIQIIEKPPVGTWLGLLNGKVGSFKFIYVDVLPEEAVGHA
RPSRRQSKGKRPKPKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRETHLNELNIMDP
QHRAKLLTAAELLLDYDTGSEEAEEGAESSQEPVAHTVSEPKVDIPRDSGCFEGSESGRD
DAELAGTEEQLQGLSLAGAP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8K352	0.539	0.539	3.788E-57	380	0.950	0.950	Q8K352.pdb.gz	SASH3_MOUSE SAM and SH3 domain-containing protein 3 OS=Mus musculus OX=10090 GN=Sash3 PE=1 SV=2
2	AFDB:Q8SZS0	0.188	0.079	8.825E-17	952	0.289	0.116	Q8SZS0.pdb.gz	Q8SZS0_DROME LD31046p OS=Drosophila melanogaster OX=7227 GN=SKIP PE=2 SV=1
3	AFDB:A0A0B4K6C1	0.199	0.088	1.981E-16	1034	0.284	0.104	A0A0B4K6C1.pdb.gz	A0A0B4K6C1_DROME Shal K[+] channel interacting protein, isoform G OS=Drosophila melanogaster OX=7227 GN=SKIP PE=4 SV=1
4	AFDB:Q6PDM6	0.142	0.049	6.829E-5	1166	0.121	0.039	Q6PDM6.pdb.gz	Q6PDM6_MOUSE Mcf.2 transforming sequence-like OS=Mus musculus OX=10090 GN=Mcf2l PE=1 SV=1
5	AFDB:W5U6G9	0.159	0.050	7.267E-5	1256	0.195	0.059	W5U6G9.pdb.gz	W5U6G9_ICTPU phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase OS=Ictalurus punctatus OX=7998 GN=inppl1a PE=2 SV=1
6	AFDB:Q24009	0.205	0.096	9.321E-5	905	0.192	0.081	Q24009.pdb.gz	BICC_DROME Protein bicaudal C OS=Drosophila melanogaster OX=7227 GN=BicC PE=1 SV=2
7	PDB:2lqnA	0.150	0.187	1.150E-4	303	0.068	0.086	2lqnA.pdb.gz
8	AFDB:Q57YV0	0.078	0.053	5.321E-4	635	0.132	0.079	Q57YV0.pdb.gz	Q57YV0_TRYB2 NOT2/NOT3/NOT5 C-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.10K10.40 PE=4 SV=1
9	AFDB:Q6NRD3	0.149	0.070	9.913E-4	826	0.118	0.054	Q6NRD3.pdb.gz	SH3R1_XENLA E3 ubiquitin-protein ligase SH3RF1 OS=Xenopus laevis OX=8355 GN=sh3rf1 PE=1 SV=1
10	PDB:2eyzA	0.158	0.195	1.149E-3	304	0.068	0.086	2eyzA.pdb.gz
11	AFDB:E1BIM8	0.141	0.081	1.271E-3	688	0.129	0.071	E1BIM8.pdb.gz	E1BIM8_BOVIN Tyrosine-protein kinase OS=Bos taurus OX=9913 GN=SRC PE=3 SV=2
12	AFDB:E9QJP6	0.161	0.096	1.271E-3	669	0.139	0.079	E9QJP6.pdb.gz
13	PDB:3ehqA	0.136	0.276	1.302E-3	182	0.058	0.121	3ehqA.pdb.gz
14	PDB:2dybA	0.139	0.175	1.474E-3	298	0.050	0.064	2dybA.pdb.gz
15	PDB:3qwyA	0.153	0.334	1.777E-3	170	0.034	0.076	3qwyA.pdb.gz
16	PDB:1griA	0.141	0.250	4.518E-3	211	0.039	0.071	1griA.pdb.gz
17	PDB:1k9aB	0.140	0.121	8.957E-3	441	0.034	0.029	1k9aB.pdb.gz
18	PDB:2h8hA	0.134	0.115	1.014E-2	445	0.034	0.029	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
19	PDB:1k0xA	0.137	0.440	1.149E-2	108	0.032	0.111	1k0xA.pdb.gz
20	PDB:4mt6A	0.129	0.126	1.473E-2	389	0.061	0.059	4mt6A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8K352	0.0	681	380	0.950	0.950	SASH3_MOUSE SAM and SH3 domain-containing protein 3 OS=Mus musculus OX=10090 GN=Sash3 PE=1 SV=2
2	P57725	8.39e-70	225	372	0.442	0.452	SAMN1_MOUSE SAM domain-containing protein SAMSN-1 OS=Mus musculus OX=10090 GN=Samsn1 PE=1 SV=2
3	P59808	1.44e-63	222	1230	0.305	0.094	SASH1_MOUSE SAM and SH3 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Sash1 PE=1 SV=1
4	Q9NSI8	2.67e-62	206	373	0.445	0.453	SAMN1_HUMAN SAM domain-containing protein SAMSN-1 OS=Homo sapiens OX=9606 GN=SAMSN1 PE=1 SV=1
5	O94885	3.42e-56	200	1247	0.305	0.093	SASH1_HUMAN SAM and SH3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SASH1 PE=1 SV=3
6	Q8T9B0	5.32e-34	135	778	0.208	0.102	Q8T9B0_DROME SD09611p OS=Drosophila melanogaster OX=7227 GN=SKIP PE=2 SV=1
7	Q8SZS0	9.40e-34	135	952	0.208	0.083	Q8SZS0_DROME LD31046p OS=Drosophila melanogaster OX=7227 GN=SKIP PE=2 SV=1
8	A0A0B4KHM3	9.90e-34	135	1027	0.208	0.077	A0A0B4KHM3_DROME Shal K[+] channel interacting protein, isoform J OS=Drosophila melanogaster OX=7227 GN=SKIP PE=4 SV=1
9	Q0KI30	1.13e-33	135	1064	0.208	0.074	Q0KI30_DROME Shal K[+] channel interacting protein, isoform E OS=Drosophila melanogaster OX=7227 GN=SKIP PE=4 SV=2
10	A0A0B4KHV7	1.40e-33	134	1080	0.208	0.073	A0A0B4KHV7_DROME Shal K[+] channel interacting protein, isoform I OS=Drosophila melanogaster OX=7227 GN=SKIP PE=4 SV=1
11	A0A0B4K6C1	7.36e-33	132	1034	0.208	0.076	A0A0B4K6C1_DROME Shal K[+] channel interacting protein, isoform G OS=Drosophila melanogaster OX=7227 GN=SKIP PE=4 SV=1
12	Q95RX2	1.08e-17	83.6	237	0.126	0.203	Q95RX2_DROME LD04190p OS=Drosophila melanogaster OX=7227 GN=SKIP PE=2 SV=1
13	Q49AR9	2.12e-06	52.0	570	0.087	0.058	Q49AR9_HUMAN ANKS1A protein OS=Homo sapiens OX=9606 GN=ANKS1A PE=1 SV=1
14	Q92625	3.51e-06	51.6	1134	0.087	0.029	ANS1A_HUMAN Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ANKS1A PE=1 SV=4
15	A0A3B3ISP1	3.67e-06	51.6	1194	0.087	0.028	A0A3B3ISP1_HUMAN Ankyrin repeat and sterile alpha motif domain containing 1A OS=Homo sapiens OX=9606 GN=ANKS1A PE=1 SV=1
16	Q8IVI9	4.81e-06	50.8	506	0.084	0.063	NOSTN_HUMAN Nostrin OS=Homo sapiens OX=9606 GN=NOSTRIN PE=1 SV=2
17	P59672	4.82e-06	51.2	1150	0.084	0.028	ANS1A_MOUSE Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus OX=10090 GN=Anks1a PE=1 SV=3
18	Q9XYM0	2.61e-05	47.8	271	0.061	0.085	CRK_DROME Adapter molecule Crk OS=Drosophila melanogaster OX=7227 GN=Crk PE=1 SV=1
19	A8WFV6	2.66e-05	48.5	537	0.097	0.069	A8WFV6_DANRE Nostrin OS=Danio rerio OX=7955 GN=nostrin PE=2 SV=1
20	Q7K115	1.20e-04	46.6	598	0.058	0.037	Q7K115_DROME LD16982p OS=Drosophila melanogaster OX=7227 GN=Nost PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00536 SAM_1	4.8e-05	35.0	SAM domain (Sterile alpha motif)
2	PF07647 SAM_2	6.4e-05	34.3	SAM domain (Sterile alpha motif)
3	PF00018 SH3_1	5.8	17.9	SH3 domain
4	PF07653 SH3_2	0.0003	31.8	Variant SH3 domain
5	PF14604 SH3_9	42	15.5	Variant SH3 domain
6	PF12485 SLY	6.2e-46	168.4	Lymphocyte signaling adaptor protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349359

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363318	0.813	Cytokine receptor common subunit gamma
2	9606.ENSP00000338641	0.741	PWWP domain-containing protein MUM1L1
3	9606.ENSP00000341905	0.714	RAS protein activator like-3
4	9606.ENSP00000293373	0.648	Nck-associated protein 1-like
5	9606.ENSP00000227752	0.646	Interleukin-10 receptor subunit alpha
6	9606.ENSP00000271324	0.640	Leukocyte surface antigen CD53
7	9606.ENSP00000355991	0.636	TRAF3-interacting JNK-activating modulator
8	9606.ENSP00000219150	0.634	Coronin-1A
9	9606.ENSP00000294507	0.634	Lysosomal-associated transmembrane protein 5
10	9606.ENSP00000248901	0.621	Cytohesin-4
11	9606.ENSP00000391583	0.620	Gamma-parvin
12	9606.ENSP00000333779	0.602	Protein EVI2B
13	9606.ENSP00000356992	0.581	Rho GTPase-activating protein 30
14	9606.ENSP00000246115	0.577	Sphingosine 1-phosphate receptor 4
15	9606.ENSP00000377380	0.575	Rho GTPase-activating protein 9
16	9606.ENSP00000349252	0.569	Integrin alpha-L
17	9606.ENSP00000380948	0.568	Integrin beta-2
18	9606.ENSP00000483570	0.564	Tyrosine-protein kinase BTK
19	9606.ENSP00000320176	0.563	Hematopoietic lineage cell-specific protein
20	9606.ENSP00000279227	0.562	Fermitin family homolog 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0042802	0.377	identical protein binding
GO:0097159	0.340	organic cyclic compound binding
GO:1901363	0.335	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0009987	0.984	cellular process
GO:0050776	0.973	regulation of immune response
GO:0048518	0.957	positive regulation of biological process
GO:0050778	0.931	positive regulation of immune response
GO:0048522	0.923	positive regulation of cellular process
GO:0009893	0.919	positive regulation of metabolic process
GO:0050863	0.911	regulation of T cell activation
GO:0010604	0.907	positive regulation of macromolecule metabolic process
GO:0002696	0.904	positive regulation of leukocyte activation
GO:0002376	0.893	immune system process
GO:0030155	0.880	regulation of cell adhesion
GO:0050864	0.877	regulation of B cell activation
GO:0010468	0.875	regulation of gene expression
GO:0050896	0.859	response to stimulus
GO:0051251	0.839	positive regulation of lymphocyte activation
GO:1903037	0.836	regulation of leukocyte cell-cell adhesion
GO:0002819	0.809	regulation of adaptive immune response
GO:1903039	0.784	positive regulation of leukocyte cell-cell adhesion
GO:0070665	0.781	positive regulation of leukocyte proliferation
GO:0032946	0.769	positive regulation of mononuclear cell proliferation
GO:0050670	0.769	regulation of lymphocyte proliferation
GO:0032501	0.646	multicellular organismal process
GO:0051716	0.598	cellular response to stimulus
GO:0050671	0.502	positive regulation of lymphocyte proliferation
GO:0032502	0.459	developmental process
GO:0048856	0.435	anatomical structure development
GO:0048519	0.424	negative regulation of biological process
GO:0023052	0.396	signaling
GO:0007154	0.396	cell communication
GO:0050870	0.379	positive regulation of T cell activation
GO:0007165	0.368	signal transduction
GO:0051094	0.323	positive regulation of developmental process
GO:2000026	0.317	regulation of multicellular organismal development
GO:0046634	0.302	regulation of alpha-beta T cell activation
GO:0030154	0.301	cell differentiation
GO:1903708	0.300	positive regulation of hemopoiesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	0.997	nucleus
GO:0016020	0.864	membrane
GO:0071944	0.720	cell periphery
GO:0005886	0.712	plasma membrane
GO:0005829	0.378	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]