StarFunc result for job id O76003

User Input

>input (335 residues)
MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKEL
PQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGS
FLPSANEHLKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFD
IFSDEEVRQGLKAYSSWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLK
VLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWP
TYPQLYVKGELVGGLDIVKELKENGELLPILRGEN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9CQM9	0.628	0.624	1.336E-61	337	0.928	0.923	Q9CQM9.pdb.gz	GLRX3_MOUSE Glutaredoxin-3 OS=Mus musculus OX=10090 GN=Glrx3 PE=1 SV=1
2	AFDB:Q5XJ54	0.451	0.462	5.434E-51	326	0.704	0.724	Q5XJ54.pdb.gz	GLRX3_DANRE Glutaredoxin 3 OS=Danio rerio OX=7955 GN=glrx3 PE=2 SV=1
3	AFDB:H2KZJ5	0.355	0.348	1.309E-40	345	0.469	0.455	H2KZJ5.pdb.gz	H2KZJ5_CAEEL Glutaredoxin 3 OS=Caenorhabditis elegans OX=6239 GN=glrx-3 PE=1 SV=1
4	AFDB:Q9ZPH2	0.344	0.249	2.398E-39	488	0.481	0.330	Q9ZPH2.pdb.gz	GRS17_ARATH Monothiol glutaredoxin-S17 OS=Arabidopsis thaliana OX=3702 GN=GRXS17 PE=1 SV=1
5	AFDB:Q6EZG4	0.362	0.356	1.411E-32	342	0.388	0.380	Q6EZG4.pdb.gz	Q6EZG4_CAEEL Glutaredoxin 3 OS=Caenorhabditis elegans OX=6239 GN=glrx-3 PE=1 SV=1
6	AFDB:Q9VJZ6	0.307	0.471	4.334E-24	216	0.290	0.449	Q9VJZ6.pdb.gz	Q9VJZ6_DROME LD40224p OS=Drosophila melanogaster OX=7227 GN=Grx4 PE=1 SV=1
7	AFDB:Q5AF81	0.314	0.413	4.440E-23	253	0.284	0.375	Q5AF81.pdb.gz	Q5AF81_CANAL Monothiol glutaredoxin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GRX3 PE=4 SV=1
8	AFDB:O74790	0.318	0.433	4.048E-22	244	0.260	0.357	O74790.pdb.gz	GLRX4_SCHPO Monothiol glutaredoxin-4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=grx4 PE=1 SV=1
9	AFDB:Q03835	0.307	0.405	9.138E-22	250	0.278	0.372	Q03835.pdb.gz	GLRX3_YEAST Monothiol glutaredoxin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GRX3 PE=1 SV=2
10	AFDB:P32642	0.304	0.415	1.088E-21	244	0.284	0.389	P32642.pdb.gz	GLRX4_YEAST Monothiol glutaredoxin-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GRX4 PE=1 SV=1
11	PDB:3f3qA	0.298	0.887	5.911E-10	109	0.087	0.266	3f3qA.pdb.gz	Structural and kinetic analysis of Saccharomyces cerevisiae thioredoxin Trx1: implications for the catalytic mechanism of GSSG reduced by the thioredoxin system
12	PDB:4ekzA	0.285	0.212	9.977E-10	469	0.152	0.109	4ekzA.pdb.gz
13	PDB:1xwaA	0.304	0.887	2.005E-9	111	0.093	0.279	1xwaA.pdb.gz
14	PDB:1r26A	0.306	0.865	2.387E-9	113	0.087	0.257	1r26A.pdb.gz
15	PDB:2fa4A	0.293	0.918	3.013E-9	104	0.087	0.279	2fa4A.pdb.gz
16	PDB:5gu6A	0.279	0.250	6.054E-9	377	0.149	0.133	5gu6A.pdb.gz
17	PDB:4j56E	0.300	0.915	9.642E-9	105	0.093	0.295	4j56E.pdb.gz	Crystal Structure of the Plasmodium falciparum Thioredoxin Reductase-Thioredoxin Complex.
18	PDB:6z7oA	0.305	0.904	1.083E-8	110	0.084	0.255	6z7oA.pdb.gz	Structures of the germline-specific Deadhead and thioredoxin T proteins from Drosophila melanogaster reveal unique features among thioredoxins.
19	PDB:4pufC	0.301	0.865	2.911E-8	112	0.084	0.250	4pufC.pdb.gz
20	PDB:6lurD	0.299	0.461	3.086E-8	213	0.104	0.164	6lurD.pdb.gz	Revisiting biomolecular NMR spectroscopy for promoting small-molecule drug discovery.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O76003	0.0	686	335	1.000	1.000	GLRX3_HUMAN Glutaredoxin-3 OS=Homo sapiens OX=9606 GN=GLRX3 PE=1 SV=2
2	Q9CQM9	0.0	620	337	0.887	0.881	GLRX3_MOUSE Glutaredoxin-3 OS=Mus musculus OX=10090 GN=Glrx3 PE=1 SV=1
3	Q9JLZ1	0.0	622	337	0.890	0.884	GLRX3_RAT Glutaredoxin-3 OS=Rattus norvegicus OX=10116 GN=Glrx3 PE=1 SV=2
4	Q5XJ54	2.38e-174	488	326	0.704	0.724	GLRX3_DANRE Glutaredoxin 3 OS=Danio rerio OX=7955 GN=glrx3 PE=2 SV=1
5	H2KZJ5	1.25e-100	301	345	0.457	0.443	H2KZJ5_CAEEL Glutaredoxin 3 OS=Caenorhabditis elegans OX=6239 GN=glrx-3 PE=1 SV=1
6	Q9ZPH2	4.99e-98	300	488	0.481	0.330	GRS17_ARATH Monothiol glutaredoxin-S17 OS=Arabidopsis thaliana OX=3702 GN=GRXS17 PE=1 SV=1
7	Q6EZG4	1.36e-78	245	342	0.382	0.374	Q6EZG4_CAEEL Glutaredoxin 3 OS=Caenorhabditis elegans OX=6239 GN=glrx-3 PE=1 SV=1
8	Q9VJZ6	4.24e-61	196	216	0.284	0.440	Q9VJZ6_DROME LD40224p OS=Drosophila melanogaster OX=7227 GN=Grx4 PE=1 SV=1
9	O74790	6.92e-55	181	244	0.257	0.352	GLRX4_SCHPO Monothiol glutaredoxin-4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=grx4 PE=1 SV=1
10	P32642	2.97e-52	174	244	0.272	0.373	GLRX4_YEAST Monothiol glutaredoxin-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GRX4 PE=1 SV=1
11	Q5AF81	4.20e-52	174	253	0.284	0.375	Q5AF81_CANAL Monothiol glutaredoxin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GRX3 PE=4 SV=1
12	Q03835	1.19e-46	160	250	0.272	0.364	GLRX3_YEAST Monothiol glutaredoxin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GRX3 PE=1 SV=2
13	Q57W40	9.18e-34	125	222	0.218	0.329	Q57W40_TRYB2 Thioredoxin-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.28F8.400 PE=4 SV=1
14	Q389T5	2.05e-28	108	131	0.143	0.366	Q389T5_TRYB2 Monothiol glutaredoxin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.406.0490 PE=4 SV=1
15	Q8H7F6	3.65e-28	112	293	0.155	0.177	GRS16_ARATH Bifunctional monothiol glutaredoxin-S16, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GRXS16 PE=1 SV=2
16	C6KSR7	6.86e-28	110	219	0.140	0.215	C6KSR7_PLAF7 Glutaredoxin-like protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0606900 PE=4 SV=1
17	Q4QJH1	8.14e-27	106	180	0.149	0.278	Q4QJH1_LEIMA Glutaredoxin-like protein OS=Leishmania major OX=5664 GN=LMJF_05_0310 PE=4 SV=1
18	Q84Y95	8.61e-27	105	173	0.143	0.277	GRS14_ARATH Monothiol glutaredoxin-S14, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GRXS14 PE=1 SV=2
19	A0A384MDT9	1.98e-25	102	157	0.131	0.280	A0A384MDT9_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
20	Q86SX6	1.98e-25	102	157	0.131	0.280	GLRX5_HUMAN Glutaredoxin-related protein 5, mitochondrial OS=Homo sapiens OX=9606 GN=GLRX5 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02966 DIM1	0.013	26.8	Mitosis protein DIM1
2	PF14106 DUF4279	4.8e+02	12.4	Domain of unknown function (DUF4279)
3	PF17898 GerD	4e+02	12.3	Spore germination GerD central core domain
4	PF00462 Glutaredoxin	2.1e-35	132.0	Glutaredoxin
5	PF20267 GREB1_C	2.7e+02	11.4	GREB1 C-terminal region
6	PF13417 GST_N_3	10	17.8	Glutathione S-transferase, N-terminal domain
7	PF07449 HyaE	3.9	18.9	Hydrogenase-1 expression protein HyaE
8	PF04756 OST3_OST6	1.1e+02	13.6	OST3 / OST6 family, transporter family
9	PF02114 Phosducin	0.017	25.7	Phosducin
10	PF04908 SH3BGR	0.00079	30.9	SH3-binding, glutamic acid-rich protein
11	PF00085 Thioredoxin	2.7e-15	67.6	Thioredoxin
12	PF13098 Thioredoxin_2	0.0045	28.8	Thioredoxin-like domain
13	PF13192 Thioredoxin_3	5.9	18.3	Thioredoxin domain
14	PF13905 Thioredoxin_8	4.8	18.8	Thioredoxin-like
15	PF14595 Thioredoxin_9	4.6e+02	12.0	Thioredoxin
16	PF12325 TMF_TATA_bd	3.2e+02	12.8	TATA element modulatory factor 1 TATA binding
17	PF09673 TrbC_Ftype	6.1e+02	11.8	Type-F conjugative transfer system pilin assembly protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357633

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377914	0.999	Anamorsin
2	9606.ENSP00000331127	0.988	BolA-like protein 2
3	9606.ENSP00000306752	0.984	bolA family member 2B
4	9606.ENSP00000358149	0.983	BolA-like protein 1
5	9606.ENSP00000264716	0.976	Fos-related antigen 2
6	9606.ENSP00000331369	0.959	BolA-like protein 3
7	9606.ENSP00000309477	0.956	Cytoplasmic aconitate hydratase
8	9606.ENSP00000356410	0.947	Glutaredoxin-2, mitochondrial
9	9606.ENSP00000258886	0.946	Iron-responsive element-binding protein 2
10	9606.ENSP00000387219	0.920	NFU1 iron-sulfur cluster scaffold homolog, mitochondrial
11	9606.ENSP00000310623	0.915	Iron-sulfur cluster assembly enzyme ISCU, mitochondrial
12	9606.ENSP00000369314	0.915	Glutaredoxin-1
13	9606.ENSP00000431813	0.907	Cysteine and glycine-rich protein 3
14	9606.ENSP00000361186	0.906	TP53-regulating kinase
15	9606.ENSP00000263125	0.870	Protein kinase C theta type
16	9606.ENSP00000365159	0.857	Iron-sulfur cluster assembly 1 homolog, mitochondrial
17	9606.ENSP00000377700	0.835	TBC1 domain family member 23
18	9606.ENSP00000412698	0.822	MMS19 nucleotide excision repair protein homolog
19	9606.ENSP00000251588	0.813	Cytosolic Fe-S cluster assembly factor NARFL
20	9606.ENSP00000452007	0.812	Iron-sulfur cluster assembly 2 homolog, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0016667	0.779	oxidoreductase activity, acting on a sulfur group of donors
GO:0042802	0.704	identical protein binding
GO:0097159	0.447	organic cyclic compound binding
GO:0015036	0.446	disulfide oxidoreductase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.979	cellular metabolic process
GO:0031163	0.947	metallo-sulfur cluster assembly
GO:0065007	0.937	biological regulation
GO:0042592	0.936	homeostatic process
GO:0050789	0.925	regulation of biological process
GO:0071704	0.914	organic substance metabolic process
GO:0045454	0.910	cell redox homeostasis
GO:0016226	0.909	iron-sulfur cluster assembly
GO:0055072	0.887	iron ion homeostasis
GO:0051604	0.884	protein maturation
GO:0050794	0.535	regulation of cellular process
GO:0048519	0.405	negative regulation of biological process
GO:0014743	0.373	regulation of muscle hypertrophy
GO:0050896	0.304	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043229	0.999	intracellular organelle
GO:0005829	0.987	cytosol
GO:0005634	0.984	nucleus
GO:0032991	0.981	protein-containing complex
GO:0043233	0.965	organelle lumen
GO:0070013	0.960	intracellular organelle lumen
GO:0043232	0.899	intracellular non-membrane-bounded organelle
GO:0099080	0.312	supramolecular complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.8.-.-	0.779	Acting on a sulfur group of donors.

[back to server]