StarFunc result for job id O76009

User Input

>input (404 residues)
MSYSCGLPSLSCRTSCSSRPCVPPSCHGCTLPGACNIPANVSNCNWFCEGSFNGSEKETM
QFLNDRLASYLEKVRQLERDNAELENLIRERSQQQEPLVCASYQSYFKTIEELQQKILCS
KSENARLVVQIDNAKLASDDFRTKYETELSLRQLVESDINGLRRILDELTLCRSDLEAQV
ESLKEELLCLKQNHEQEVNTLRCQLGDRLNVEVDAAPTVDLNQVLNETRSQYEALVETNR
REVEQWFATQTEELNKQVVSSSEQLQSYQAEIIELRRTVNALEIELQAQHNLRDSLENTL
TESEARYSSQLSQVQRLITNVESQLAEIRSDLERQNQEYQVLLDVRARLECEINTYRSLL
ESEDCKLPSNPCATTNACDKSTGPCISNPCGLRARCGPCNTFGY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15323	0.858	0.835	2.652E-44	416	0.936	0.909	Q15323.pdb.gz	K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens OX=9606 GN=KRT31 PE=1 SV=3
2	AFDB:O76011	0.757	0.705	8.931E-42	436	0.871	0.807	O76011.pdb.gz	KRT34_HUMAN Keratin, type I cuticular Ha4 OS=Homo sapiens OX=9606 GN=KRT34 PE=1 SV=3
3	AFDB:Q92764	0.676	0.610	4.577E-31	455	0.703	0.624	Q92764.pdb.gz	KRT35_HUMAN Keratin, type I cuticular Ha5 OS=Homo sapiens OX=9606 GN=KRT35 PE=1 SV=5
4	AFDB:Q14532	0.755	0.686	4.922E-31	448	0.676	0.609	Q14532.pdb.gz	K1H2_HUMAN Keratin, type I cuticular Ha2 OS=Homo sapiens OX=9606 GN=KRT32 PE=1 SV=3
5	AFDB:O76013	0.710	0.620	9.472E-31	467	0.708	0.612	O76013.pdb.gz	KRT36_HUMAN Keratin, type I cuticular Ha6 OS=Homo sapiens OX=9606 GN=KRT36 PE=1 SV=1
6	AFDB:B1AQ75	0.508	0.447	1.299E-29	473	0.678	0.579	B1AQ75.pdb.gz	KRT36_MOUSE Keratin, type I cuticular Ha6 OS=Mus musculus OX=10090 GN=Krt36 PE=1 SV=1
7	AFDB:Q6A162	0.604	0.573	4.069E-27	431	0.611	0.573	Q6A162.pdb.gz	K1C40_HUMAN Keratin, type I cytoskeletal 40 OS=Homo sapiens OX=9606 GN=KRT40 PE=1 SV=2
8	AFDB:O76015	0.753	0.679	1.507E-26	456	0.611	0.542	O76015.pdb.gz	KRT38_HUMAN Keratin, type I cuticular Ha8 OS=Homo sapiens OX=9606 GN=KRT38 PE=1 SV=3
9	AFDB:Q6A163	0.490	0.411	4.602E-25	491	0.574	0.473	Q6A163.pdb.gz	K1C39_HUMAN Keratin, type I cytoskeletal 39 OS=Homo sapiens OX=9606 GN=KRT39 PE=1 SV=2
10	AFDB:Q6IFW3	0.686	0.584	5.725E-25	481	0.557	0.468	Q6IFW3.pdb.gz	K1C39_RAT Keratin, type I cytoskeletal 39 OS=Rattus norvegicus OX=10116 GN=Krt39 PE=3 SV=1
11	PDB:8at3A	0.172	0.230	9.332	286	0.099	0.140	8at3A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B1AQ75	0.0	520	473	0.693	0.592	KRT36_MOUSE Keratin, type I cuticular Ha6 OS=Mus musculus OX=10090 GN=Krt36 PE=1 SV=1
2	O76009	0.0	812	404	1.000	1.000	KT33A_HUMAN Keratin, type I cuticular Ha3-I OS=Homo sapiens OX=9606 GN=KRT33A PE=2 SV=2
3	O76011	0.0	696	436	0.871	0.807	KRT34_HUMAN Keratin, type I cuticular Ha4 OS=Homo sapiens OX=9606 GN=KRT34 PE=1 SV=3
4	O76013	0.0	541	467	0.691	0.597	KRT36_HUMAN Keratin, type I cuticular Ha6 OS=Homo sapiens OX=9606 GN=KRT36 PE=1 SV=1
5	Q14525	0.0	758	404	0.938	0.938	KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sapiens OX=9606 GN=KRT33B PE=1 SV=3
6	Q14532	0.0	530	448	0.671	0.605	K1H2_HUMAN Keratin, type I cuticular Ha2 OS=Homo sapiens OX=9606 GN=KRT32 PE=1 SV=3
7	Q15323	0.0	751	416	0.936	0.909	K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens OX=9606 GN=KRT31 PE=1 SV=3
8	Q92764	0.0	528	455	0.715	0.635	KRT35_HUMAN Keratin, type I cuticular Ha5 OS=Homo sapiens OX=9606 GN=KRT35 PE=1 SV=5
9	O76015	9.98e-172	489	456	0.611	0.542	KRT38_HUMAN Keratin, type I cuticular Ha8 OS=Homo sapiens OX=9606 GN=KRT38 PE=1 SV=3
10	O76014	1.52e-164	471	449	0.597	0.537	KRT37_HUMAN Keratin, type I cuticular Ha7 OS=Homo sapiens OX=9606 GN=KRT37 PE=1 SV=3
11	Q6A162	1.63e-162	465	431	0.606	0.568	K1C40_HUMAN Keratin, type I cytoskeletal 40 OS=Homo sapiens OX=9606 GN=KRT40 PE=1 SV=2
12	Q6A163	1.38e-148	432	491	0.574	0.473	K1C39_HUMAN Keratin, type I cytoskeletal 39 OS=Homo sapiens OX=9606 GN=KRT39 PE=1 SV=2
13	Q6IFW3	5.81e-146	425	481	0.542	0.455	K1C39_RAT Keratin, type I cytoskeletal 39 OS=Rattus norvegicus OX=10116 GN=Krt39 PE=3 SV=1
14	P02533	1.38e-129	383	472	0.475	0.407	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4
15	Q6PVZ1	4.46e-129	381	467	0.473	0.409	K1C14_CHICK Keratin, type I cytoskeletal 14 OS=Gallus gallus OX=9031 GN=KRT14 PE=2 SV=1
16	Q6IFU8	6.81e-129	380	433	0.473	0.441	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
17	Q9QWL7	8.46e-129	379	433	0.473	0.441	K1C17_MOUSE Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3
18	Q04695	2.74e-128	378	432	0.488	0.456	K1C17_HUMAN Keratin, type I cytoskeletal 17 OS=Homo sapiens OX=9606 GN=KRT17 PE=1 SV=2
19	P08727	3.01e-127	374	400	0.443	0.448	K1C19_HUMAN Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4
20	P08779	3.11e-127	377	473	0.473	0.404	K1C16_HUMAN Keratin, type I cytoskeletal 16 OS=Homo sapiens OX=9606 GN=KRT16 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00038 Filament	1.7e-103	358.1	Intermediate filament protein
2	PF07926 TPR_MLP1_2	1e+02	14.3	TPR/MLP1/MLP2-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000007735

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000301656	0.648	Keratin, type I cytoskeletal 27
2	9606.ENSP00000308452	0.595	Keratin, type I cytoskeletal 17
3	9606.ENSP00000305263	0.588	Keratin, type I cytoskeletal 28
4	9606.ENSP00000310573	0.584	Keratin, type I cytoskeletal 25
5	9606.ENSP00000254043	0.572	Keratin, type I cytoskeletal 15
6	9606.ENSP00000167586	0.569	Keratin, type I cytoskeletal 14
7	9606.ENSP00000301653	0.565	Keratin, type I cytoskeletal 16
8	9606.ENSP00000246635	0.551	Keratin, type I cytoskeletal 13
9	9606.ENSP00000246662	0.550	Keratin, type I cytoskeletal 9
10	9606.ENSP00000264651	0.550	Keratin, type I cytoskeletal 24
11	9606.ENSP00000251643	0.544	Keratin, type I cytoskeletal 12
12	9606.ENSP00000269576	0.543	Keratin, type I cytoskeletal 10
13	9606.ENSP00000167588	0.533	Keratin, type I cytoskeletal 20
14	9606.ENSP00000355124	0.533	Keratin, type I cytoskeletal 19
15	9606.ENSP00000334798	0.529	Keratin, type I cytoskeletal 26
16	9606.ENSP00000209718	0.518	Keratin, type I cytoskeletal 23
17	9606.ENSP00000373487	0.510	Keratin, type I cytoskeletal 18
18	9606.ENSP00000382590	0.503	Keratin associated protein 5-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.988	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032502	0.998	developmental process
GO:0048856	0.966	anatomical structure development
GO:0008544	0.859	epidermis development
GO:0032501	0.508	multicellular organismal process
GO:0009987	0.443	cellular process
GO:0042633	0.339	hair cycle
GO:0007568	0.321	aging

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005576	0.998	extracellular region
GO:0043226	0.997	organelle
GO:0005615	0.990	extracellular space
GO:0043227	0.933	membrane-bounded organelle
GO:0070062	0.901	extracellular exosome
GO:0043229	0.750	intracellular organelle
GO:0043232	0.572	intracellular non-membrane-bounded organelle
GO:0005856	0.349	cytoskeleton
GO:0045111	0.305	intermediate filament cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]