StarFunc result for job id O76011

User Input

>input (436 residues)
MLYAKPPPTINGIKGLQRKERLKPAHIHLQQLTCFSITCSSTMSYSCCLPSLGCRTSCSS
RPCVPPSCHGYTLPGACNIPANVSNCNWFCEGSFNGSEKETMQFLNDRLASYLEKVRQLE
RDNAELEKLIQERSQQQEPLLCPSYQSYFKTIEELQQKILCAKAENARLVVNIDNAKLAS
DDFRSKYQTEQSLRLLVESDINSIRRILDELTLCKSDLESQVESLREELICLKKNHEEEV
NTLRSQLGDRLNVEVDTAPTVDLNQVLNETRSQYEALVEINRREVEQWFATQTEELNKQV
VSSSEQLQSCQAEIIELRRTVNALEIELQAQHNLRDSLENTLTESEAHYSSQLSQVQSLI
TNVESQLAEIRCDLERQNQEYQVLLDVRARLECEINTYRSLLESEDCKLPCNPCATTNAS
GNSCGPCGTSQKGCCN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O76011	1.000	1.000	8.448E-58	436	1.000	1.000	O76011.pdb.gz	KRT34_HUMAN Keratin, type I cuticular Ha4 OS=Homo sapiens OX=9606 GN=KRT34 PE=1 SV=3
2	AFDB:Q15323	0.640	0.667	3.700E-39	416	0.800	0.839	Q15323.pdb.gz	K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens OX=9606 GN=KRT31 PE=1 SV=3
3	AFDB:Q14532	0.695	0.679	1.029E-31	448	0.610	0.594	Q14532.pdb.gz	K1H2_HUMAN Keratin, type I cuticular Ha2 OS=Homo sapiens OX=9606 GN=KRT32 PE=1 SV=3
4	AFDB:O76013	0.619	0.583	2.547E-31	467	0.640	0.597	O76013.pdb.gz	KRT36_HUMAN Keratin, type I cuticular Ha6 OS=Homo sapiens OX=9606 GN=KRT36 PE=1 SV=1
5	AFDB:Q92764	0.641	0.618	4.447E-31	455	0.640	0.613	Q92764.pdb.gz	KRT35_HUMAN Keratin, type I cuticular Ha5 OS=Homo sapiens OX=9606 GN=KRT35 PE=1 SV=5
6	AFDB:B1AQ75	0.529	0.494	4.122E-29	473	0.617	0.569	B1AQ75.pdb.gz	KRT36_MOUSE Keratin, type I cuticular Ha6 OS=Mus musculus OX=10090 GN=Krt36 PE=1 SV=1
7	AFDB:Q6A162	0.631	0.638	1.020E-28	431	0.594	0.601	Q6A162.pdb.gz	K1C40_HUMAN Keratin, type I cytoskeletal 40 OS=Homo sapiens OX=9606 GN=KRT40 PE=1 SV=2
8	AFDB:O76015	0.663	0.638	3.324E-27	456	0.564	0.539	O76015.pdb.gz	KRT38_HUMAN Keratin, type I cuticular Ha8 OS=Homo sapiens OX=9606 GN=KRT38 PE=1 SV=3
9	AFDB:Q6IFW3	0.572	0.524	1.165E-26	481	0.532	0.482	Q6IFW3.pdb.gz	K1C39_RAT Keratin, type I cytoskeletal 39 OS=Rattus norvegicus OX=10116 GN=Krt39 PE=3 SV=1
10	AFDB:Q6A163	0.470	0.424	6.204E-26	491	0.541	0.481	Q6A163.pdb.gz	K1C39_HUMAN Keratin, type I cytoskeletal 39 OS=Homo sapiens OX=9606 GN=KRT39 PE=1 SV=2
11	PDB:5gm6P	0.087	0.148	3.192	246	0.057	0.102	5gm6P.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
12	PDB:5wlcST	0.124	0.093	7.365	599	0.030	0.022	5wlcST.pdb.gz	The complete structure of the small-subunit processome.
13	PDB:7w5a2	0.148	0.364	8.466	123	0.037	0.130	7w5a2.pdb.gz	Mechanism of exon ligation by human spliceosome.
14	PDB:7ajtCL	0.117	0.070	9.077	781	0.034	0.019	7ajtCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
15	PDB:7d4iRJ	0.120	0.075	9.077	738	0.039	0.023	7d4iRJ.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O76009	0.0	696	404	0.807	0.871	KT33A_HUMAN Keratin, type I cuticular Ha3-I OS=Homo sapiens OX=9606 GN=KRT33A PE=2 SV=2
2	O76011	0.0	882	436	1.000	1.000	KRT34_HUMAN Keratin, type I cuticular Ha4 OS=Homo sapiens OX=9606 GN=KRT34 PE=1 SV=3
3	O76013	0.0	531	467	0.626	0.585	KRT36_HUMAN Keratin, type I cuticular Ha6 OS=Homo sapiens OX=9606 GN=KRT36 PE=1 SV=1
4	Q14525	0.0	693	404	0.810	0.874	KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sapiens OX=9606 GN=KRT33B PE=1 SV=3
5	Q14532	0.0	520	448	0.608	0.592	K1H2_HUMAN Keratin, type I cuticular Ha2 OS=Homo sapiens OX=9606 GN=KRT32 PE=1 SV=3
6	Q15323	0.0	689	416	0.798	0.837	K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens OX=9606 GN=KRT31 PE=1 SV=3
7	Q92764	0.0	520	455	0.633	0.607	KRT35_HUMAN Keratin, type I cuticular Ha5 OS=Homo sapiens OX=9606 GN=KRT35 PE=1 SV=5
8	B1AQ75	5.26e-179	510	473	0.610	0.562	KRT36_MOUSE Keratin, type I cuticular Ha6 OS=Mus musculus OX=10090 GN=Krt36 PE=1 SV=1
9	Q6A162	6.27e-169	483	431	0.589	0.596	K1C40_HUMAN Keratin, type I cytoskeletal 40 OS=Homo sapiens OX=9606 GN=KRT40 PE=1 SV=2
10	O76015	8.05e-164	471	456	0.548	0.524	KRT38_HUMAN Keratin, type I cuticular Ha8 OS=Homo sapiens OX=9606 GN=KRT38 PE=1 SV=3
11	O76014	1.53e-161	464	449	0.537	0.521	KRT37_HUMAN Keratin, type I cuticular Ha7 OS=Homo sapiens OX=9606 GN=KRT37 PE=1 SV=3
12	Q6A163	3.40e-143	419	491	0.509	0.452	K1C39_HUMAN Keratin, type I cytoskeletal 39 OS=Homo sapiens OX=9606 GN=KRT39 PE=1 SV=2
13	Q6IFW3	1.69e-140	412	481	0.493	0.447	K1C39_RAT Keratin, type I cytoskeletal 39 OS=Rattus norvegicus OX=10116 GN=Krt39 PE=3 SV=1
14	Q6PVZ1	3.37e-129	383	467	0.429	0.400	K1C14_CHICK Keratin, type I cytoskeletal 14 OS=Gallus gallus OX=9031 GN=KRT14 PE=2 SV=1
15	Q6IFU8	3.01e-128	379	433	0.440	0.443	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
16	Q04695	4.22e-128	379	432	0.429	0.433	K1C17_HUMAN Keratin, type I cytoskeletal 17 OS=Homo sapiens OX=9606 GN=KRT17 PE=1 SV=2
17	Q9QWL7	4.81e-128	379	433	0.440	0.443	K1C17_MOUSE Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3
18	P02533	2.27e-126	376	472	0.424	0.392	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4
19	Q6IFV1	4.16e-126	375	485	0.422	0.379	K1C14_RAT Keratin, type I cytoskeletal 14 OS=Rattus norvegicus OX=10116 GN=Krt14 PE=2 SV=1
20	P08727	1.06e-125	372	400	0.399	0.435	K1C19_HUMAN Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00038 Filament	6.4e-101	349.7	Intermediate filament protein
2	PF03361 Herpes_IE2_3	9.7e+02	11.0	Herpes virus intermediate/early protein 2/3
3	PF12827 Peroxin-22	1.4e+02	13.8	Peroxisomal biogenesis protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377570

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368447	0.719	GPALPP motifs containing 1
2	9606.ENSP00000278520	0.690	Coiled-coil domain containing 82
3	9606.ENSP00000355302	0.641	Keratin-associated protein 1-5
4	9606.ENSP00000375237	0.628	Keratin associated protein 2-3
5	9606.ENSP00000419101	0.582	Voltage-dependent calcium channel subunit alpha-2/delta-3
6	9606.ENSP00000246662	0.547	Keratin, type I cytoskeletal 9
7	9606.ENSP00000251646	0.540	Keratin, type I cuticular Ha3-II
8	9606.ENSP00000301653	0.533	Keratin, type I cytoskeletal 16
9	9606.ENSP00000308452	0.533	Keratin, type I cytoskeletal 17
10	9606.ENSP00000334798	0.531	Keratin, type I cytoskeletal 26
11	9606.ENSP00000167588	0.528	Keratin, type I cytoskeletal 20
12	9606.ENSP00000254043	0.528	Keratin, type I cytoskeletal 15
13	9606.ENSP00000373487	0.528	Keratin, type I cytoskeletal 18
14	9606.ENSP00000301656	0.525	Keratin, type I cytoskeletal 27
15	9606.ENSP00000167586	0.520	Keratin, type I cytoskeletal 14
16	9606.ENSP00000310573	0.520	Keratin, type I cytoskeletal 25
17	9606.ENSP00000375430	0.519	Keratin-associated protein 3-1
18	9606.ENSP00000269576	0.516	Keratin, type I cytoskeletal 10
19	9606.ENSP00000251643	0.514	Keratin, type I cytoskeletal 12
20	9606.ENSP00000264651	0.514	Keratin, type I cytoskeletal 24

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.846	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.988	developmental process
GO:0048856	0.956	anatomical structure development
GO:0008544	0.935	epidermis development
GO:0009987	0.504	cellular process
GO:0032501	0.332	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0005576	0.996	extracellular region
GO:0005615	0.991	extracellular space
GO:0043226	0.982	organelle
GO:0043232	0.929	intracellular non-membrane-bounded organelle
GO:0043227	0.899	membrane-bounded organelle
GO:0043230	0.880	extracellular organelle
GO:0070062	0.866	extracellular exosome
GO:0005856	0.411	cytoskeleton
GO:0045111	0.368	intermediate filament cytoskeleton
GO:0005882	0.320	intermediate filament

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]