StarFunc result for job id O76013

User Input

>input (467 residues)
MATQTCTPTFSTGSIKGLCGTAGGISRVSSIRSVGSCRVPSLAGAAGYISSARSGLSGLG
SCLPGSYLSSECHTSGFVGSGGWFCEGSFNGSEKETMQFLNDRLANYLEKVRQLERENAE
LESRIQEWYEFQIPYICPDYQSYFKTIEDFQQKILLTKSENARLVLQIDNAKLAADDFRT
KYETELSLRQLVEADINGLRRILDELTLCKADLEAQVESLKEELMCLKKNHEEEVSVLRC
QLGDRLNVEVDAAPPVDLNKILEDMRCQYEALVENNRRDVEAWFNTQTEELNQQVVSSSE
QLQCCQTEIIELRRTVNALEIELQAQHSMRNSLESTLAETEARYSSQLAQMQCLISNVEA
QLSEIRCDLERQNQEYQVLLDVKARLEGEIATYRHLLEGEDCKLPPQPCATACKPVIRVP
SVPPVPCVPSVPCTPAPQVGTQIRTITEEIRDGKVISSREHVQSRPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O76013	1.000	1.000	2.359E-63	467	1.000	1.000	O76013.pdb.gz	KRT36_HUMAN Keratin, type I cuticular Ha6 OS=Homo sapiens OX=9606 GN=KRT36 PE=1 SV=1
2	AFDB:B1AQ75	0.465	0.460	1.076E-50	473	0.846	0.835	B1AQ75.pdb.gz	KRT36_MOUSE Keratin, type I cuticular Ha6 OS=Mus musculus OX=10090 GN=Krt36 PE=1 SV=1
3	AFDB:Q92764	0.609	0.624	3.441E-36	455	0.664	0.681	Q92764.pdb.gz	KRT35_HUMAN Keratin, type I cuticular Ha5 OS=Homo sapiens OX=9606 GN=KRT35 PE=1 SV=5
4	AFDB:Q14532	0.635	0.660	1.694E-32	448	0.636	0.663	Q14532.pdb.gz	K1H2_HUMAN Keratin, type I cuticular Ha2 OS=Homo sapiens OX=9606 GN=KRT32 PE=1 SV=3
5	AFDB:Q6IFW3	0.659	0.641	3.298E-31	481	0.576	0.559	Q6IFW3.pdb.gz	K1C39_RAT Keratin, type I cytoskeletal 39 OS=Rattus norvegicus OX=10116 GN=Krt39 PE=3 SV=1
6	AFDB:Q15323	0.625	0.698	5.657E-31	416	0.621	0.697	Q15323.pdb.gz	K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens OX=9606 GN=KRT31 PE=1 SV=3
7	AFDB:Q6IFV1	0.573	0.553	1.101E-29	485	0.529	0.509	Q6IFV1.pdb.gz	K1C14_RAT Keratin, type I cytoskeletal 14 OS=Rattus norvegicus OX=10116 GN=Krt14 PE=2 SV=1
8	AFDB:Q6PVZ1	0.419	0.419	1.766E-29	467	0.531	0.531	Q6PVZ1.pdb.gz	K1C14_CHICK Keratin, type I cytoskeletal 14 OS=Gallus gallus OX=9031 GN=KRT14 PE=2 SV=1
9	AFDB:P02533	0.510	0.506	2.314E-29	472	0.533	0.528	P02533.pdb.gz	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4
10	AFDB:Q6A162	0.477	0.511	2.314E-29	431	0.559	0.606	Q6A162.pdb.gz	K1C40_HUMAN Keratin, type I cytoskeletal 40 OS=Homo sapiens OX=9606 GN=KRT40 PE=1 SV=2
11	PDB:2ymwB	0.051	0.035	3.618	685	0.011	0.007	2ymwB.pdb.gz
12	PDB:3j7aZ	0.052	0.262	4.141	72	0.011	0.069	3j7aZ.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
13	PDB:6mpbB	0.044	0.046	4.141	446	0.009	0.009	6mpbB.pdb.gz	Cryo-EM structures of the human glutamine transporter SLC1A5 (ASCT2) in the outward-facing conformation.
14	PDB:6fhmA	0.047	0.101	4.430	193	0.006	0.016	6fhmA.pdb.gz
15	PDB:6v8oQ	0.047	0.078	5.070	264	0.006	0.011	6v8oQ.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
16	PDB:7eqgD	0.041	0.061	5.070	309	0.013	0.019	7eqgD.pdb.gz	AcrIF5 specifically targets DNA-bound CRISPR-Cas surveillance complex for inhibition.
17	PDB:2hw1A	0.041	0.061	5.424	296	0.009	0.014	2hw1A.pdb.gz	Structures of alternatively spliced isoforms of human ketohexokinase.
18	PDB:6jj7A	0.050	0.050	5.424	465	0.013	0.013	6jj7A.pdb.gz	Crystal structure of OsHXK6-Glc complex
19	PDB:6hivDH	0.043	0.037	6.641	564	0.021	0.018	6hivDH.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
20	PDB:1u6zB	0.039	0.037	7.104	500	0.006	0.006	1u6zB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B1AQ75	0.0	817	473	0.846	0.835	KRT36_MOUSE Keratin, type I cuticular Ha6 OS=Mus musculus OX=10090 GN=Krt36 PE=1 SV=1
2	O76009	0.0	542	404	0.617	0.713	KT33A_HUMAN Keratin, type I cuticular Ha3-I OS=Homo sapiens OX=9606 GN=KRT33A PE=2 SV=2
3	O76011	0.0	530	436	0.585	0.626	KRT34_HUMAN Keratin, type I cuticular Ha4 OS=Homo sapiens OX=9606 GN=KRT34 PE=1 SV=3
4	O76013	0.0	956	467	1.000	1.000	KRT36_HUMAN Keratin, type I cuticular Ha6 OS=Homo sapiens OX=9606 GN=KRT36 PE=1 SV=1
5	Q14525	0.0	535	404	0.610	0.705	KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sapiens OX=9606 GN=KRT33B PE=1 SV=3
6	Q14532	0.0	575	448	0.636	0.663	K1H2_HUMAN Keratin, type I cuticular Ha2 OS=Homo sapiens OX=9606 GN=KRT32 PE=1 SV=3
7	Q15323	0.0	545	416	0.606	0.680	K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens OX=9606 GN=KRT31 PE=1 SV=3
8	Q92764	0.0	590	455	0.664	0.681	KRT35_HUMAN Keratin, type I cuticular Ha5 OS=Homo sapiens OX=9606 GN=KRT35 PE=1 SV=5
9	Q6A162	8.18e-175	499	431	0.555	0.601	K1C40_HUMAN Keratin, type I cytoskeletal 40 OS=Homo sapiens OX=9606 GN=KRT40 PE=1 SV=2
10	Q6A163	1.36e-161	468	491	0.585	0.556	K1C39_HUMAN Keratin, type I cytoskeletal 39 OS=Homo sapiens OX=9606 GN=KRT39 PE=1 SV=2
11	O76015	5.73e-160	462	456	0.514	0.526	KRT38_HUMAN Keratin, type I cuticular Ha8 OS=Homo sapiens OX=9606 GN=KRT38 PE=1 SV=3
12	Q6IFW3	5.24e-158	458	481	0.546	0.530	K1C39_RAT Keratin, type I cytoskeletal 39 OS=Rattus norvegicus OX=10116 GN=Krt39 PE=3 SV=1
13	O76014	2.01e-156	453	449	0.529	0.550	KRT37_HUMAN Keratin, type I cuticular Ha7 OS=Homo sapiens OX=9606 GN=KRT37 PE=1 SV=3
14	Q6IFU8	4.55e-151	439	433	0.510	0.550	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
15	Q9QWL7	5.45e-150	436	433	0.510	0.550	K1C17_MOUSE Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3
16	Q6PVZ1	1.65e-145	426	467	0.471	0.471	K1C14_CHICK Keratin, type I cytoskeletal 14 OS=Gallus gallus OX=9031 GN=KRT14 PE=2 SV=1
17	Q04695	1.03e-143	420	432	0.463	0.500	K1C17_HUMAN Keratin, type I cytoskeletal 17 OS=Homo sapiens OX=9606 GN=KRT17 PE=1 SV=2
18	P02533	3.03e-141	415	472	0.460	0.456	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4
19	P08727	3.92e-139	407	400	0.422	0.492	K1C19_HUMAN Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4
20	P19001	8.62e-139	406	403	0.433	0.501	K1C19_MOUSE Keratin, type I cytoskeletal 19 OS=Mus musculus OX=10090 GN=Krt19 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00038 Filament	2.9e-107	370.5	Intermediate filament protein
2	PF14389 Lzipper-MIP1	77	15.0	Leucine-zipper of ternary complex factor MIP1
3	PF07926 TPR_MLP1_2	6.2e+02	11.8	TPR/MLP1/MLP2-like protein
4	PF19913 WCOB	19	17.1	Wolframin C-terminal OB-fold domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000329165

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361785	0.701	Dual specificity protein phosphatase 13 isoform B
2	9606.ENSP00000301656	0.653	Keratin, type I cytoskeletal 27
3	9606.ENSP00000301263	0.574	Lymphocyte antigen 6D
4	9606.ENSP00000296695	0.572	Serine protease inhibitor Kazal-type 1
5	9606.ENSP00000246662	0.529	Keratin, type I cytoskeletal 9
6	9606.ENSP00000167586	0.524	Keratin, type I cytoskeletal 14
7	9606.ENSP00000251643	0.516	Keratin, type I cytoskeletal 12
8	9606.ENSP00000254043	0.516	Keratin, type I cytoskeletal 15
9	9606.ENSP00000269576	0.516	Keratin, type I cytoskeletal 10
10	9606.ENSP00000301653	0.516	Keratin, type I cytoskeletal 16
11	9606.ENSP00000308452	0.515	Keratin, type I cytoskeletal 17
12	9606.ENSP00000402219	0.514	V-set and immunoglobulin domain containing 1
13	9606.ENSP00000310573	0.513	Keratin, type I cytoskeletal 25
14	9606.ENSP00000246635	0.512	Keratin, type I cytoskeletal 13
15	9606.ENSP00000209718	0.511	Keratin, type I cytoskeletal 23
16	9606.ENSP00000355124	0.507	Keratin, type I cytoskeletal 19
17	9606.ENSP00000373487	0.507	Keratin, type I cytoskeletal 18
18	9606.ENSP00000264651	0.505	Keratin, type I cytoskeletal 24
19	9606.ENSP00000305263	0.504	Keratin, type I cytoskeletal 28
20	9606.ENSP00000334798	0.501	Keratin, type I cytoskeletal 26

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.969	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.973	developmental process
GO:0009987	0.835	cellular process
GO:0048856	0.736	anatomical structure development
GO:0050789	0.485	regulation of biological process
GO:0008544	0.394	epidermis development
GO:0050794	0.348	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0045111	0.995	intermediate filament cytoskeleton
GO:0070062	0.995	extracellular exosome
GO:0099512	0.962	supramolecular fiber
GO:0005882	0.954	intermediate filament
GO:0045095	0.352	keratin filament

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]