StarFunc result for job id O76014

User Input

>input (449 residues)
MTSFYSTSSCPLGCTMAPGARNVFVSPIDVGCQPVAEANAASMCLLANVAHANRVRVGST
PLGRPSLCLPPTSHTACPLPGTCHIPGNIGICGAYGKNTLNGHEKETMKFLNDRLANYLE
KVRQLEQENAELETTLLERSKCHESTVCPDYQSYFRTIEELQQKILCSKAENARLIVQID
NAKLAADDFRIKLESERSLHQLVEADKCGTQKLLDDATLAKADLEAQQESLKEEQLSLKS
NHEQEVKILRSQLGEKFRIELDIEPTIDLNRVLGEMRAQYEAMVETNHQDVEQWFQAQSE
GISLQAMSCSEELQCCQSEILELRCTVNALEVERQAQHTLKDCLQNSLCEAEDRYGTELA
QMQSLISNLEEQLSEIRADLERQNQEYQVLLDVKARLENEIATYRNLLESEDCKLPCNPC
STPASCTSCPSCGPVTGGSPSGHGASMGR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O76015	0.430	0.424	2.637E-51	456	0.918	0.904	O76015.pdb.gz	KRT38_HUMAN Keratin, type I cuticular Ha8 OS=Homo sapiens OX=9606 GN=KRT38 PE=1 SV=3
2	AFDB:O76011	0.468	0.481	1.313E-29	436	0.539	0.555	O76011.pdb.gz	KRT34_HUMAN Keratin, type I cuticular Ha4 OS=Homo sapiens OX=9606 GN=KRT34 PE=1 SV=3
3	AFDB:Q92764	0.478	0.473	2.568E-28	455	0.543	0.536	Q92764.pdb.gz	KRT35_HUMAN Keratin, type I cuticular Ha5 OS=Homo sapiens OX=9606 GN=KRT35 PE=1 SV=5
4	AFDB:Q15323	0.448	0.481	4.586E-28	416	0.541	0.584	Q15323.pdb.gz	K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens OX=9606 GN=KRT31 PE=1 SV=3
5	AFDB:Q14532	0.456	0.457	2.261E-27	448	0.552	0.554	Q14532.pdb.gz	K1H2_HUMAN Keratin, type I cuticular Ha2 OS=Homo sapiens OX=9606 GN=KRT32 PE=1 SV=3
6	AFDB:B1AQ75	0.515	0.493	5.397E-27	473	0.526	0.499	B1AQ75.pdb.gz	KRT36_MOUSE Keratin, type I cuticular Ha6 OS=Mus musculus OX=10090 GN=Krt36 PE=1 SV=1
7	AFDB:O76013	0.425	0.410	1.036E-26	467	0.548	0.527	O76013.pdb.gz	KRT36_HUMAN Keratin, type I cuticular Ha6 OS=Homo sapiens OX=9606 GN=KRT36 PE=1 SV=1
8	AFDB:Q6A162	0.446	0.459	8.640E-25	431	0.492	0.513	Q6A162.pdb.gz	K1C40_HUMAN Keratin, type I cytoskeletal 40 OS=Homo sapiens OX=9606 GN=KRT40 PE=1 SV=2
9	AFDB:Q6IFW3	0.414	0.390	7.608E-24	481	0.465	0.435	Q6IFW3.pdb.gz	K1C39_RAT Keratin, type I cytoskeletal 39 OS=Rattus norvegicus OX=10116 GN=Krt39 PE=3 SV=1
10	AFDB:Q6A163	0.600	0.555	8.180E-24	491	0.490	0.448	Q6A163.pdb.gz	K1C39_HUMAN Keratin, type I cytoskeletal 39 OS=Homo sapiens OX=9606 GN=KRT39 PE=1 SV=2
11	PDB:5lj5O	0.078	0.116	3.404	283	0.051	0.081	5lj5O.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
12	PDB:7w5a2	0.107	0.350	3.404	123	0.031	0.114	7w5a2.pdb.gz	Mechanism of exon ligation by human spliceosome.
13	PDB:6zqaUB	0.104	0.095	4.549	504	0.036	0.032	6zqaUB.pdb.gz	90 S pre-ribosome transformation into the primordial 40 S subunit.
14	PDB:7d5sRN	0.116	0.088	6.080	607	0.029	0.021	7d5sRN.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
15	PDB:7w59R	0.075	0.120	6.080	280	0.051	0.082	7w59R.pdb.gz	Mechanism of exon ligation by human spliceosome.
16	PDB:7qooU	0.159	0.311	7.029	186	0.073	0.177	7qooU.pdb.gz	Structure of the human inner kinetochore CCAN complex and its significance for human centromere organization.
17	PDB:5wlcST	0.094	0.075	7.557	599	0.040	0.030	5wlcST.pdb.gz	The complete structure of the small-subunit processome.
18	PDB:7mqaSI	0.109	0.067	7.557	803	0.029	0.016	7mqaSI.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:7aavv	0.097	0.204	8.126	206	0.040	0.087	7aavv.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
20	PDB:6wucH	0.071	0.162	8.737	179	0.082	0.207	6wucH.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O76014	0.0	922	449	1.000	1.000	KRT37_HUMAN Keratin, type I cuticular Ha7 OS=Homo sapiens OX=9606 GN=KRT37 PE=1 SV=3
2	O76015	0.0	818	456	0.918	0.904	KRT38_HUMAN Keratin, type I cuticular Ha8 OS=Homo sapiens OX=9606 GN=KRT38 PE=1 SV=3
3	Q15323	7.32e-166	475	416	0.526	0.567	K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens OX=9606 GN=KRT31 PE=1 SV=3
4	O76009	1.69e-164	471	404	0.537	0.597	KT33A_HUMAN Keratin, type I cuticular Ha3-I OS=Homo sapiens OX=9606 GN=KRT33A PE=2 SV=2
5	Q14525	2.12e-162	466	404	0.530	0.589	KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sapiens OX=9606 GN=KRT33B PE=1 SV=3
6	O76011	1.57e-161	464	436	0.521	0.537	KRT34_HUMAN Keratin, type I cuticular Ha4 OS=Homo sapiens OX=9606 GN=KRT34 PE=1 SV=3
7	Q14532	1.91e-157	454	448	0.541	0.542	K1H2_HUMAN Keratin, type I cuticular Ha2 OS=Homo sapiens OX=9606 GN=KRT32 PE=1 SV=3
8	O76013	1.69e-156	453	467	0.548	0.527	KRT36_HUMAN Keratin, type I cuticular Ha6 OS=Homo sapiens OX=9606 GN=KRT36 PE=1 SV=1
9	B1AQ75	8.15e-153	444	473	0.517	0.490	KRT36_MOUSE Keratin, type I cuticular Ha6 OS=Mus musculus OX=10090 GN=Krt36 PE=1 SV=1
10	Q92764	5.74e-149	433	455	0.537	0.530	KRT35_HUMAN Keratin, type I cuticular Ha5 OS=Homo sapiens OX=9606 GN=KRT35 PE=1 SV=5
11	Q6A162	2.91e-133	392	431	0.494	0.515	K1C40_HUMAN Keratin, type I cytoskeletal 40 OS=Homo sapiens OX=9606 GN=KRT40 PE=1 SV=2
12	Q6A163	1.67e-120	362	491	0.457	0.418	K1C39_HUMAN Keratin, type I cytoskeletal 39 OS=Homo sapiens OX=9606 GN=KRT39 PE=1 SV=2
13	Q6IFW3	5.64e-120	360	481	0.439	0.410	K1C39_RAT Keratin, type I cytoskeletal 39 OS=Rattus norvegicus OX=10116 GN=Krt39 PE=3 SV=1
14	Q6PVZ1	2.23e-106	325	467	0.365	0.351	K1C14_CHICK Keratin, type I cytoskeletal 14 OS=Gallus gallus OX=9031 GN=KRT14 PE=2 SV=1
15	Q6IFU8	1.91e-105	321	433	0.381	0.395	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
16	Q9QWL7	2.50e-105	321	433	0.381	0.395	K1C17_MOUSE Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3
17	P19001	2.99e-105	320	403	0.359	0.400	K1C19_MOUSE Keratin, type I cytoskeletal 19 OS=Mus musculus OX=10090 GN=Krt19 PE=1 SV=1
18	Q04695	3.91e-104	318	432	0.365	0.380	K1C17_HUMAN Keratin, type I cytoskeletal 17 OS=Homo sapiens OX=9606 GN=KRT17 PE=1 SV=2
19	Q63279	2.97e-103	315	403	0.350	0.390	K1C19_RAT Keratin, type I cytoskeletal 19 OS=Rattus norvegicus OX=10116 GN=Krt19 PE=1 SV=2
20	Q61414	1.80e-102	314	452	0.363	0.361	K1C15_MOUSE Keratin, type I cytoskeletal 15 OS=Mus musculus OX=10090 GN=Krt15 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16888 DUF5082	43	15.8	Domain of unknown function (DUF5082)
2	PF00038 Filament	1.1e-88	309.5	Intermediate filament protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000225550

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000334798	0.534	Keratin, type I cytoskeletal 26
2	9606.ENSP00000310573	0.531	Keratin, type I cytoskeletal 25
3	9606.ENSP00000305263	0.527	Keratin, type I cytoskeletal 28
4	9606.ENSP00000209718	0.525	Keratin, type I cytoskeletal 23
5	9606.ENSP00000301653	0.523	Keratin, type I cytoskeletal 16
6	9606.ENSP00000246635	0.518	Keratin, type I cytoskeletal 13
7	9606.ENSP00000264651	0.518	Keratin, type I cytoskeletal 24
8	9606.ENSP00000246662	0.514	Keratin, type I cytoskeletal 9
9	9606.ENSP00000301656	0.510	Keratin, type I cytoskeletal 27
10	9606.ENSP00000308452	0.506	Keratin, type I cytoskeletal 17
11	9606.ENSP00000167586	0.505	Keratin, type I cytoskeletal 14
12	9606.ENSP00000269576	0.505	Keratin, type I cytoskeletal 10
13	9606.ENSP00000254043	0.504	Keratin, type I cytoskeletal 15
14	9606.ENSP00000251643	0.503	Keratin, type I cytoskeletal 12
15	9606.ENSP00000373487	0.501	Keratin, type I cytoskeletal 18

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.997	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.983	developmental process
GO:0009987	0.919	cellular process
GO:0048856	0.868	anatomical structure development
GO:0009888	0.436	tissue development
GO:0008544	0.364	epidermis development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0070062	0.997	extracellular exosome
GO:0043232	0.967	intracellular non-membrane-bounded organelle
GO:0005856	0.952	cytoskeleton
GO:0005882	0.941	intermediate filament

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]