StarFunc result for job id O76015

User Input

>input (456 residues)
MTSSYSSSSCPLGCTMAPGARNVSVSPIDIGCQPGAEANIAPMCLLANVAHANRVRVGST
PLGRPSLCLPPTCHTACPLPGTCHIPGNIGICGAYGENTLNGHEKETMQFLNDRLANYLE
KVRQLEQENAELEATLLERSKCHESTVCPDYQSYFHTIEELQQKILCSKAENARLIVQID
NAKLAADDFRIKLESERSLRQLVEADKCGTQKLLDDATLAKADLEAQQESLKEEQLSLKS
NHEQEVKILRSQLGEKLRIELDIEPTIDLNRVLGEMRAQYEAMLETNRQDVEQWFQAQSE
GISLQDMSCSEELQCCQSEILELRCTVNALEVERQAQHTLKDCLQNSLCEAEDRFGTELA
QMQSLISNVEEQLSEIRADLERQNQEYQVLLDVKTRLENEIATYRNLLESEDCKLPCNPC
STSPSCVTAPCAPRPSCGPCTTCGPTCGASTTGSRF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O76015	1.000	1.000	1.093E-57	456	1.000	1.000	O76015.pdb.gz	KRT38_HUMAN Keratin, type I cuticular Ha8 OS=Homo sapiens OX=9606 GN=KRT38 PE=1 SV=3
2	AFDB:O76011	0.641	0.666	1.012E-26	436	0.535	0.560	O76011.pdb.gz	KRT34_HUMAN Keratin, type I cuticular Ha4 OS=Homo sapiens OX=9606 GN=KRT34 PE=1 SV=3
3	AFDB:O76013	0.593	0.581	4.424E-25	467	0.539	0.527	O76013.pdb.gz	KRT36_HUMAN Keratin, type I cuticular Ha6 OS=Homo sapiens OX=9606 GN=KRT36 PE=1 SV=1
4	AFDB:Q92764	0.557	0.558	4.424E-25	455	0.559	0.560	Q92764.pdb.gz	KRT35_HUMAN Keratin, type I cuticular Ha5 OS=Homo sapiens OX=9606 GN=KRT35 PE=1 SV=5
5	AFDB:Q14532	0.635	0.645	5.794E-25	448	0.559	0.569	Q14532.pdb.gz	K1H2_HUMAN Keratin, type I cuticular Ha2 OS=Homo sapiens OX=9606 GN=KRT32 PE=1 SV=3
6	AFDB:B1AQ75	0.441	0.428	5.017E-24	473	0.533	0.514	B1AQ75.pdb.gz	KRT36_MOUSE Keratin, type I cuticular Ha6 OS=Mus musculus OX=10090 GN=Krt36 PE=1 SV=1
7	AFDB:Q6A162	0.538	0.565	3.762E-22	431	0.487	0.515	Q6A162.pdb.gz	K1C40_HUMAN Keratin, type I cytoskeletal 40 OS=Homo sapiens OX=9606 GN=KRT40 PE=1 SV=2
8	AFDB:Q6A163	0.404	0.381	9.043E-22	491	0.491	0.456	Q6A163.pdb.gz	K1C39_HUMAN Keratin, type I cytoskeletal 39 OS=Homo sapiens OX=9606 GN=KRT39 PE=1 SV=2
9	AFDB:Q6IFW3	0.589	0.561	1.659E-21	481	0.474	0.449	Q6IFW3.pdb.gz	K1C39_RAT Keratin, type I cytoskeletal 39 OS=Rattus norvegicus OX=10116 GN=Krt39 PE=3 SV=1
10	AFDB:Q6IFV4	0.549	0.569	2.796E-19	438	0.414	0.432	Q6IFV4.pdb.gz	K1C13_RAT Keratin, type I cytoskeletal 13 OS=Rattus norvegicus OX=10116 GN=Krt13 PE=3 SV=1
11	PDB:6zqaUB	0.083	0.076	7.065	504	0.037	0.034	6zqaUB.pdb.gz	90 S pre-ribosome transformation into the primordial 40 S subunit.
12	PDB:7w5a2	0.109	0.348	8.086	123	0.031	0.114	7w5a2.pdb.gz	Mechanism of exon ligation by human spliceosome.
13	PDB:7mqaNA	0.070	0.105	9.899	295	0.035	0.054	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O76014	0.0	830	449	0.904	0.918	KRT37_HUMAN Keratin, type I cuticular Ha7 OS=Homo sapiens OX=9606 GN=KRT37 PE=1 SV=3
2	O76015	0.0	929	456	1.000	1.000	KRT38_HUMAN Keratin, type I cuticular Ha8 OS=Homo sapiens OX=9606 GN=KRT38 PE=1 SV=3
3	Q14525	4.91e-173	493	404	0.546	0.616	KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sapiens OX=9606 GN=KRT33B PE=1 SV=3
4	O76009	4.17e-172	490	404	0.542	0.611	KT33A_HUMAN Keratin, type I cuticular Ha3-I OS=Homo sapiens OX=9606 GN=KRT33A PE=2 SV=2
5	Q15323	3.69e-170	486	416	0.544	0.596	K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens OX=9606 GN=KRT31 PE=1 SV=3
6	O76011	5.15e-164	471	436	0.524	0.548	KRT34_HUMAN Keratin, type I cuticular Ha4 OS=Homo sapiens OX=9606 GN=KRT34 PE=1 SV=3
7	Q14532	3.68e-160	462	448	0.535	0.545	K1H2_HUMAN Keratin, type I cuticular Ha2 OS=Homo sapiens OX=9606 GN=KRT32 PE=1 SV=3
8	B1AQ75	2.38e-157	456	473	0.515	0.497	KRT36_MOUSE Keratin, type I cuticular Ha6 OS=Mus musculus OX=10090 GN=Krt36 PE=1 SV=1
9	O76013	3.17e-157	455	467	0.531	0.518	KRT36_HUMAN Keratin, type I cuticular Ha6 OS=Homo sapiens OX=9606 GN=KRT36 PE=1 SV=1
10	Q92764	1.63e-152	442	455	0.550	0.552	KRT35_HUMAN Keratin, type I cuticular Ha5 OS=Homo sapiens OX=9606 GN=KRT35 PE=1 SV=5
11	Q6A162	1.18e-135	399	431	0.493	0.522	K1C40_HUMAN Keratin, type I cytoskeletal 40 OS=Homo sapiens OX=9606 GN=KRT40 PE=1 SV=2
12	Q6A163	8.03e-123	368	491	0.493	0.458	K1C39_HUMAN Keratin, type I cytoskeletal 39 OS=Homo sapiens OX=9606 GN=KRT39 PE=1 SV=2
13	Q6IFW3	1.58e-121	364	481	0.482	0.457	K1C39_RAT Keratin, type I cytoskeletal 39 OS=Rattus norvegicus OX=10116 GN=Krt39 PE=3 SV=1
14	Q9QWL7	2.55e-109	332	433	0.386	0.406	K1C17_MOUSE Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3
15	Q6IFU8	8.41e-108	328	433	0.384	0.404	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
16	Q6PVZ1	3.49e-107	327	467	0.364	0.355	K1C14_CHICK Keratin, type I cytoskeletal 14 OS=Gallus gallus OX=9031 GN=KRT14 PE=2 SV=1
17	P19001	4.66e-106	322	403	0.355	0.402	K1C19_MOUSE Keratin, type I cytoskeletal 19 OS=Mus musculus OX=10090 GN=Krt19 PE=1 SV=1
18	Q04695	6.94e-106	323	432	0.366	0.387	K1C17_HUMAN Keratin, type I cytoskeletal 17 OS=Homo sapiens OX=9606 GN=KRT17 PE=1 SV=2
19	P08727	1.93e-104	318	400	0.346	0.395	K1C19_HUMAN Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4
20	Q63279	2.81e-104	318	403	0.349	0.395	K1C19_RAT Keratin, type I cytoskeletal 19 OS=Rattus norvegicus OX=10116 GN=Krt19 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16888 DUF5082	12	17.6	Domain of unknown function (DUF5082)
2	PF00038 Filament	2.9e-88	308.1	Intermediate filament protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000246646

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000330720	0.594	Keratin-associated protein 11-1
2	9606.ENSP00000334866	0.582	Keratin-associated protein 15-1
3	9606.ENSP00000375430	0.573	Keratin-associated protein 3-1
4	9606.ENSP00000375151	0.567	Keratin-associated protein 4-3
5	9606.ENSP00000305263	0.566	Keratin, type I cytoskeletal 28
6	9606.ENSP00000334798	0.557	Keratin, type I cytoskeletal 26
7	9606.ENSP00000310573	0.553	Keratin, type I cytoskeletal 25
8	9606.ENSP00000301656	0.542	Keratin, type I cytoskeletal 27
9	9606.ENSP00000209718	0.535	Keratin, type I cytoskeletal 23
10	9606.ENSP00000347635	0.527	Keratin-associated protein 13-1
11	9606.ENSP00000246662	0.525	Keratin, type I cytoskeletal 9
12	9606.ENSP00000369317	0.524	Keratin, type II cytoskeletal 6A
13	9606.ENSP00000449404	0.521	Keratin, type II cytoskeletal 8
14	9606.ENSP00000264651	0.519	Keratin, type I cytoskeletal 24
15	9606.ENSP00000332690	0.517	Keratin-associated protein 6-1
16	9606.ENSP00000269576	0.515	Keratin, type I cytoskeletal 10
17	9606.ENSP00000308452	0.514	Keratin, type I cytoskeletal 17
18	9606.ENSP00000254043	0.510	Keratin, type I cytoskeletal 15
19	9606.ENSP00000251643	0.509	Keratin, type I cytoskeletal 12
20	9606.ENSP00000301653	0.509	Keratin, type I cytoskeletal 16

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.998	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032502	0.995	developmental process
GO:0048856	0.781	anatomical structure development
GO:0009987	0.510	cellular process
GO:0008544	0.466	epidermis development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0031982	0.996	vesicle
GO:0005615	0.995	extracellular space
GO:0043230	0.988	extracellular organelle
GO:0070062	0.978	extracellular exosome
GO:0043232	0.929	intracellular non-membrane-bounded organelle
GO:0005856	0.841	cytoskeleton
GO:0005882	0.830	intermediate filament

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]