StarFunc result for job id O76024

User Input

>input (890 residues)
MDSNTAPLGPSCPQPPPAPQPQARSRLNATASLEQERSERPRAPGPQAGPGPGVRDAAAP
AEPQAQHTRSRERADGTGPTKGDMEIPFEEVLERAKAGDPKAQTEVGKHYLQLAGDTDEE
LNSCTAVDWLVLAAKQGRREAVKLLRRCLADRRGITSENEREVRQLSSETDLERAVRKAA
LVMYWKLNPKKKKQVAVAELLENVGQVNEHDGGAQPGPVPKSLQKQRRMLERLVSSESKN
YIALDDFVEITKKYAKGVIPSSLFLQDDEDDDELAGKSPEDLPLRLKVVKYPLHAIMEIK
EYLIDMASRAGMHWLSTIIPTHHINALIFFFIVSNLTIDFFAFFIPLVIFYLSFISMVIC
TLKVFQDSKAWENFRTLTDLLLRFEPNLDVEQAEVNFGWNHLEPYAHFLLSVFFVIFSFP
IASKDCIPCSELAVITGFFTVTSYLSLSTHAEPYTRRALATEVTAGLLSLLPSMPLNWPY
LKVLGQTFITVPVGHLVVLNVSVPCLLYVYLLYLFFRMAQLRNFKGTYCYLVPYLVCFMW
CELSVVILLESTGLGLLRASIGYFLFLFALPILVAGLALVGVLQFARWFTSLELTKIAVT
VAVCSVPLLLRWWTKASFSVVGMVKSLTRSSMVKLILVWLTAIVLFCWFYVYRSEGMKVY
NSTLTWQQYGALCGPRAWKETNMARTQILCSHLEGHRVTWTGRFKYVRVTDIDNSAESAI
NMLPFFIGDWMRCLYGEAYPACSPGNTSTAEEELCRLKLLAKHPCHIKKFDRYKFEITVG
MPFSSGADGSRSREEDDVTKDIVLRASSEFKSVLLSLRQGSLIEFSTILEGRLGSKWPVF
ELKAISCLNCMAQLSPTRRHVKIEHDWRSTVHGAVKFAFDFFFFPFLSAA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PT53	0.858	0.858	0.000	890	0.865	0.865	E9PT53.pdb.gz	E9PT53_RAT Wolframin ER transmembrane glycoprotein OS=Rattus norvegicus OX=10116 GN=Wfs1 PE=1 SV=2
2	AFDB:O76024	1.000	1.000	0.000	890	1.000	1.000	O76024.pdb.gz	WFS1_HUMAN Wolframin OS=Homo sapiens OX=9606 GN=WFS1 PE=1 SV=2
3	AFDB:E7F921	0.829	0.824	2.771E-84	895	0.548	0.545	E7F921.pdb.gz	E7F921_DANRE Wolfram syndrome 1b (wolframin) OS=Danio rerio OX=7955 GN=wfs1b PE=4 SV=1
4	AFDB:Q8IMZ9	0.592	0.615	8.523E-36	853	0.227	0.237	Q8IMZ9.pdb.gz	WFS1_DROME Wolframin OS=Drosophila melanogaster OX=7227 GN=wfs1 PE=1 SV=2
5	AFDB:Q5ZAJ0	0.071	0.070	7.197E-3	905	0.080	0.078	Q5ZAJ0.pdb.gz	RBOHB_ORYSJ Respiratory burst oxidase homolog protein B OS=Oryza sativa subsp. japonica OX=39947 GN=RBOHB PE=1 SV=1
6	PDB:3jc52	0.091	0.130	1.251E-1	584	0.025	0.038	3jc52.pdb.gz
7	AFDB:P57796	0.069	0.154	1.658E-1	275	0.046	0.149	P57796.pdb.gz	CABP4_HUMAN Calcium-binding protein 4 OS=Homo sapiens OX=9606 GN=CABP4 PE=1 SV=2
8	AFDB:B7ZNG0	0.072	0.053	1.893E-1	1348	0.097	0.064	B7ZNG0.pdb.gz	KIF7_MOUSE Kinesin-like protein KIF7 OS=Mus musculus OX=10090 GN=Kif7 PE=1 SV=1
9	PDB:6skl7	0.091	0.122	2.035E-1	635	0.027	0.038	6skl7.pdb.gz	Cryo-EM Structure of the Fork Protection Complex Bound to CMG at a Replication Fork.
10	PDB:7pfo4	0.084	0.116	2.035E-1	619	0.019	0.027	7pfo4.pdb.gz	Structure of a human replisome shows the organisation and interactions of a DNA replication machine.
11	AFDB:Q06190	0.075	0.063	2.161E-1	1150	0.047	0.037	Q06190.pdb.gz	P2R3A_HUMAN Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha OS=Homo sapiens OX=9606 GN=PPP2R3A PE=1 SV=1
12	AFDB:Q8VHC5	0.082	0.179	2.161E-1	271	0.036	0.118	Q8VHC5.pdb.gz	CABP4_MOUSE Calcium-binding protein 4 OS=Mus musculus OX=10090 GN=Cabp4 PE=1 SV=1
13	PDB:7plo3	0.095	0.129	2.323E-1	628	0.020	0.029	7plo3.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
14	AFDB:B3DKN2	0.062	0.086	2.360E-1	537	0.035	0.058	B3DKN2.pdb.gz	B3DKN2_DANRE Nr5a5 protein OS=Danio rerio OX=7955 GN=fd46g06 PE=2 SV=1
15	PDB:6pkxB	0.070	0.062	2.428E-1	1218	0.089	0.065	6pkxB.pdb.gz	Visualizing structural transitions of ligand-dependent gating of the TRPM2 channel.
16	PDB:6raw5	0.098	0.145	2.428E-1	576	0.021	0.033	6raw5.pdb.gz	Molecular Basis for ATP-Hydrolysis-Driven DNA Translocation by the CMG Helicase of the Eukaryotic Replisome.
17	PDB:7pmk5	0.099	0.128	2.428E-1	673	0.017	0.022	7pmk5.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
18	PDB:7plo7	0.083	0.118	2.538E-1	607	0.024	0.035	7plo7.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
19	PDB:6rax2	0.091	0.125	2.772E-1	605	0.027	0.040	6rax2.pdb.gz	Molecular Basis for ATP-Hydrolysis-Driven DNA Translocation by the CMG Helicase of the Eukaryotic Replisome.
20	PDB:6raz7	0.086	0.123	3.165E-1	601	0.029	0.043	6raz7.pdb.gz	Molecular Basis for ATP-Hydrolysis-Driven DNA Translocation by the CMG Helicase of the Eukaryotic Replisome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A452	0.0	1445	858	0.789	0.818	A0A8I6A452_RAT Wolframin ER transmembrane glycoprotein OS=Rattus norvegicus OX=10116 GN=Wfs1 PE=1 SV=1
2	E7F921	0.0	990	895	0.535	0.532	E7F921_DANRE Wolfram syndrome 1b (wolframin) OS=Danio rerio OX=7955 GN=wfs1b PE=4 SV=1
3	E9PT53	0.0	1535	890	0.843	0.843	E9PT53_RAT Wolframin ER transmembrane glycoprotein OS=Rattus norvegicus OX=10116 GN=Wfs1 PE=1 SV=2
4	O76024	0.0	1838	890	1.000	1.000	WFS1_HUMAN Wolframin OS=Homo sapiens OX=9606 GN=WFS1 PE=1 SV=2
5	P56695	0.0	1541	890	0.849	0.849	WFS1_MOUSE Wolframin OS=Mus musculus OX=10090 GN=Wfs1 PE=1 SV=1
6	Q9JLT5	0.0	1537	890	0.843	0.843	Q9JLT5_RAT WFS1 OS=Rattus norvegicus OX=10116 GN=Wfs1 PE=2 SV=1
7	Q8IMZ9	4.33e-53	201	853	0.233	0.243	WFS1_DROME Wolframin OS=Drosophila melanogaster OX=7227 GN=wfs1 PE=1 SV=2
8	P77234	0.26	37.0	325	0.029	0.080	YBEQ_ECOLI Sel1-repeat-containing protein YbeQ OS=Escherichia coli (strain K12) OX=83333 GN=ybeQ PE=4 SV=2
9	E9PH18	0.31	36.2	211	0.021	0.090	E9PH18_HUMAN DnaJ heat shock protein family (Hsp40) member B6 OS=Homo sapiens OX=9606 GN=DNAJB6 PE=1 SV=1
10	M9MS40	0.33	37.4	3282	0.022	0.006	M9MS40_DROME histone acetyltransferase OS=Drosophila melanogaster OX=7227 GN=nej PE=1 SV=1
11	M9PH39	0.33	37.4	3266	0.022	0.006	M9PH39_DROME histone acetyltransferase OS=Drosophila melanogaster OX=7227 GN=nej PE=1 SV=1
12	Q9W321	0.33	37.4	3276	0.022	0.006	Q9W321_DROME histone acetyltransferase OS=Drosophila melanogaster OX=7227 GN=nej PE=1 SV=2
13	A0A0H2VDN9	0.42	36.6	490	0.021	0.039	ESIB_ECOL6 Secretory immunoglobulin A-binding protein EsiB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=esiB PE=1 SV=1
14	Q38CX9	0.47	36.6	1378	0.040	0.026	Q38CX9_TRYB2 CHAT domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.244.2660 PE=4 SV=1
15	Q5JXX2	1.3	33.9	177	0.038	0.192	Q5JXX2_HUMAN Mortality factor 4 like 2 (Fragment) OS=Homo sapiens OX=9606 GN=MORF4L2 PE=1 SV=1
16	Q9UBV2	1.3	35.0	794	0.029	0.033	SE1L1_HUMAN Protein sel-1 homolog 1 OS=Homo sapiens OX=9606 GN=SEL1L PE=1 SV=3
17	Q9Z2G6	1.5	35.0	790	0.029	0.033	SE1L1_MOUSE Protein sel-1 homolog 1 OS=Mus musculus OX=10090 GN=Sel1l PE=1 SV=2
18	Q5JXX1	1.6	33.5	158	0.038	0.215	Q5JXX1_HUMAN Mortality factor 4 like 2 (Fragment) OS=Homo sapiens OX=9606 GN=MORF4L2 PE=1 SV=1
19	P51436	2.7	33.9	387	0.029	0.067	DRD4_MOUSE D(4) dopamine receptor OS=Mus musculus OX=10090 GN=Drd4 PE=1 SV=1
20	Q704Y3	3.0	33.9	839	0.027	0.029	TRPV1_MOUSE Transient receptor potential cation channel subfamily V member 1 OS=Mus musculus OX=10090 GN=Trpv1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12645 HTH_16	41	15.7	Helix-turn-helix domain
2	PF20053 WC-rich	6.6e-35	131.1	Wolframin cysteine-rich domain
3	PF19913 WCOB	4.2e-26	103.2	Wolframin C-terminal OB-fold domain
4	PF19914 WEF-hand	2.7e-15	68.4	Wolframin EF-hand domain
5	PF20023 WSLR	6.3e-20	82.5	Wolframin Sel1-like repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000226760

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216037	0.957	X-box-binding protein 1
2	9606.ENSP00000356919	0.924	Cyclic AMP-dependent transcription factor ATF-6 alpha
3	9606.ENSP00000273986	0.902	CDGSH iron-sulfur domain-containing protein 2
4	9606.ENSP00000286355	0.838	Adenylate cyclase type 8
5	9606.ENSP00000364349	0.837	Cyclic AMP-dependent transcription factor ATF-6 beta
6	9606.ENSP00000187762	0.816	Trimeric intracellular cation channel type A
7	9606.ENSP00000356790	0.799	Sodium/potassium-transporting ATPase subunit beta-1
8	9606.ENSP00000274695	0.762	Threonylcarbamoyladenosine tRNA methylthiotransferase
9	9606.ENSP00000282728	0.741	Hematopoietically-expressed homeobox protein HHEX
10	9606.ENSP00000385995	0.732	Thyroid adenoma-associated protein
11	9606.ENSP00000345708	0.722	ATP-sensitive inward rectifier potassium channel 11
12	9606.ENSP00000371634	0.710	Insulin-like growth factor 2 mRNA-binding protein 2
13	9606.ENSP00000415011	0.710	Zinc transporter 8
14	9606.ENSP00000358404	0.709	Transcription factor 7-like 2
15	9606.ENSP00000283928	0.708	Juxtaposed with another zinc finger protein 1
16	9606.ENSP00000363041	0.706	CDGSH iron-sulfur domain-containing protein 1
17	9606.ENSP00000281141	0.704	Cell division cycle protein 123 homolog
18	9606.ENSP00000257068	0.681	Melatonin receptor type 1B
19	9606.ENSP00000229771	0.668	Tubby-related protein 1
20	9606.ENSP00000155840	0.667	Potassium voltage-gated channel subfamily KQT member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0048306	1.000	calcium-dependent protein binding
GO:0005516	1.000	calmodulin binding
GO:0051117	0.999	ATPase binding
GO:0044389	0.969	ubiquitin-like protein ligase binding
GO:0031625	0.829	ubiquitin protein ligase binding
GO:0044877	0.390	protein-containing complex binding
GO:0070628	0.343	proteasome binding
GO:0140297	0.302	DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.973	regulation of cellular process
GO:0050896	0.970	response to stimulus
GO:0009987	0.955	cellular process
GO:0042221	0.952	response to chemical
GO:0032501	0.951	multicellular organismal process
GO:0032502	0.893	developmental process
GO:1903573	0.875	negative regulation of response to endoplasmic reticulum stress
GO:0048856	0.859	anatomical structure development
GO:0071704	0.847	organic substance metabolic process
GO:0031323	0.836	regulation of cellular metabolic process
GO:0044238	0.825	primary metabolic process
GO:0044237	0.807	cellular metabolic process
GO:0034976	0.807	response to endoplasmic reticulum stress
GO:0023051	0.799	regulation of signaling
GO:0010556	0.799	regulation of macromolecule biosynthetic process
GO:0031647	0.797	regulation of protein stability
GO:0031326	0.793	regulation of cellular biosynthetic process
GO:0010468	0.786	regulation of gene expression
GO:0010646	0.785	regulation of cell communication
GO:0080090	0.777	regulation of primary metabolic process
GO:0009966	0.772	regulation of signal transduction
GO:0051171	0.769	regulation of nitrogen compound metabolic process
GO:0048518	0.744	positive regulation of biological process
GO:0009892	0.732	negative regulation of metabolic process
GO:0006807	0.728	nitrogen compound metabolic process
GO:0010605	0.724	negative regulation of macromolecule metabolic process
GO:0048513	0.715	animal organ development
GO:0042981	0.685	regulation of apoptotic process
GO:1900101	0.666	regulation of endoplasmic reticulum unfolded protein response
GO:0031016	0.663	pancreas development
GO:0051172	0.636	negative regulation of nitrogen compound metabolic process
GO:0050821	0.627	protein stabilization
GO:0010604	0.627	positive regulation of macromolecule metabolic process
GO:0051252	0.622	regulation of RNA metabolic process
GO:0043170	0.617	macromolecule metabolic process
GO:0031324	0.617	negative regulation of cellular metabolic process
GO:1901564	0.594	organonitrogen compound metabolic process
GO:0010033	0.591	response to organic substance
GO:0051173	0.582	positive regulation of nitrogen compound metabolic process
GO:0065009	0.579	regulation of molecular function
GO:0051246	0.578	regulation of protein metabolic process
GO:0019538	0.569	protein metabolic process
GO:0006355	0.566	regulation of DNA-templated transcription
GO:0010243	0.564	response to organonitrogen compound
GO:0042048	0.546	olfactory behavior
GO:0043161	0.543	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0010648	0.542	negative regulation of cell communication
GO:0023057	0.539	negative regulation of signaling
GO:0048522	0.512	positive regulation of cellular process
GO:0009968	0.512	negative regulation of signal transduction
GO:0045934	0.497	negative regulation of nucleobase-containing compound metabolic process
GO:0031327	0.494	negative regulation of cellular biosynthetic process
GO:0010558	0.493	negative regulation of macromolecule biosynthetic process
GO:0051253	0.492	negative regulation of RNA metabolic process
GO:0043066	0.483	negative regulation of apoptotic process
GO:0044092	0.481	negative regulation of molecular function
GO:1904035	0.478	regulation of epithelial cell apoptotic process
GO:1903320	0.470	regulation of protein modification by small protein conjugation or removal
GO:1904036	0.455	negative regulation of epithelial cell apoptotic process
GO:0031398	0.454	positive regulation of protein ubiquitination
GO:0051090	0.409	regulation of DNA-binding transcription factor activity
GO:0003008	0.336	system process
GO:0007154	0.323	cell communication
GO:0050877	0.321	nervous system process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0012505	1.000	endomembrane system
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0031090	0.994	organelle membrane
GO:0031982	0.975	vesicle
GO:0097708	0.926	intracellular vesicle
GO:0031410	0.920	cytoplasmic vesicle
GO:0099503	0.877	secretory vesicle
GO:0005783	0.834	endoplasmic reticulum
GO:0031974	0.664	membrane-enclosed lumen
GO:0070013	0.645	intracellular organelle lumen
GO:0098588	0.531	bounding membrane of organelle
GO:0031981	0.506	nuclear lumen
GO:0030054	0.505	cell junction
GO:0005654	0.464	nucleoplasm
GO:0005829	0.326	cytosol
GO:0071944	0.301	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]