StarFunc result for job id O76031

User Input

>input (633 residues)
MPSCGACTCGAAAVRLITSSLASAQRGISGGRIHMSVLGRLGTFETQILQRAPLRSFTET
PAYFASKDGISKDGSGDGNKKSASEGSSKKSGSGNSGKGGNQLRCPKCGDLCTHVETFVS
STRFVKCEKCHHFFVVLSEADSKKSIIKEPESAAEAVKLAFQQKPPPPPKKIYNYLDKYV
VGQSFAKKVLSVAVYNHYKRIYNNIPANLRQQAEVEKQTSLTPRELEIRRREDEYRFTKL
LQIAGISPHGNALGASMQQQVNQQIPQEKRGGEVLDSSHDDIKLEKSNILLLGPTGSGKT
LLAQTLAKCLDVPFAICDCTTLTQAGYVGEDIESVIAKLLQDANYNVEKAQQGIVFLDEV
DKIGSVPGIHQLRDVGGEGVQQGLLKLLEGTIVNVPEKNSRKLRGETVQVDTTNILFVAS
GAFNGLDRIISRRKNEKYLGFGTPSNLGKGRRAAAAADLANRSGESNTHQDIEEKDRLLR
HVEARDLIEFGMIPEFVGRLPVVVPLHSLDEKTLVQILTEPRNAVIPQYQALFSMDKCEL
NVTEDALKAIARLALERKTGARGLRSIMEKLLLEPMFEVPNSDIVCVEVDKEVVEGKKEP
GYIRAPTKESSEEEYDSGVEEEGWPRQADAANS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9JHS4	0.700	0.699	6.776E-104	634	0.959	0.957	Q9JHS4.pdb.gz	CLPX_MOUSE ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Mus musculus OX=10090 GN=Clpx PE=1 SV=2
2	AFDB:P0CAU2	0.531	0.792	2.472E-45	420	0.338	0.510	P0CAU2.pdb.gz	CLPX_CAUVC ATP-dependent Clp protease ATP-binding subunit ClpX OS=Caulobacter vibrioides (strain ATCC 19089 / CB15) OX=190650 GN=clpX PE=1 SV=1
3	AFDB:P0A6H1	0.536	0.789	8.132E-45	424	0.324	0.483	P0A6H1.pdb.gz	CLPX_ECOLI ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli (strain K12) OX=83333 GN=clpX PE=1 SV=2
4	AFDB:P50866	0.525	0.781	8.033E-43	420	0.314	0.474	P50866.pdb.gz	CLPX_BACSU ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus subtilis (strain 168) OX=224308 GN=clpX PE=2 SV=3
5	AFDB:P9WPB9	0.515	0.754	1.499E-42	426	0.318	0.472	P9WPB9.pdb.gz	CLPX_MYCTU ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=clpX PE=1 SV=1
6	AFDB:P38323	0.529	0.639	1.817E-41	520	0.283	0.344	P38323.pdb.gz	CLPX_YEAST ATP-dependent clpX-like chaperone, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MCX1 PE=1 SV=1
7	PDB:5txvT	0.378	0.723	3.003E-19	318	0.166	0.330	5txvT.pdb.gz	Covalently linked HslU hexamers support a probabilistic mechanism that links ATP hydrolysis to protein unfolding and translocation.
8	PDB:6pxkF	0.385	0.611	8.820E-19	388	0.171	0.278	6pxkF.pdb.gz	Heat activates the AAA+ HslUV protease by melting an axial autoinhibitory plug.
9	PDB:1im2A	0.393	0.696	1.555E-18	346	0.179	0.327	1im2A.pdb.gz	Structure of Haemophilus influenzae HslU protein in crystals with one-dimensional disorder twinning.
10	PDB:1g3iA	0.387	0.731	1.951E-18	326	0.171	0.331	1g3iA.pdb.gz	Crystal and solution structures of an HslUV protease-chaperone complex.
11	PDB:1e94E	0.409	0.621	2.590E-18	408	0.171	0.265	1e94E.pdb.gz	Mutational Studies on Hslu and its Docking Mode with Hslv
12	PDB:5txvB	0.382	0.691	2.901E-18	337	0.164	0.309	5txvB.pdb.gz	Covalently linked HslU hexamers support a probabilistic mechanism that links ATP hydrolysis to protein unfolding and translocation.
13	PDB:5txvX	0.375	0.643	7.607E-18	360	0.164	0.289	5txvX.pdb.gz	Covalently linked HslU hexamers support a probabilistic mechanism that links ATP hydrolysis to protein unfolding and translocation.
14	PDB:6pxkK	0.385	0.555	1.502E-17	429	0.171	0.252	6pxkK.pdb.gz	Heat activates the AAA+ HslUV protease by melting an axial autoinhibitory plug.
15	PDB:1qvrA	0.359	0.290	2.153E-11	803	0.120	0.095	1qvrA.pdb.gz	The Structure of ClpB: A Molecular Chaperone that Rescues Proteins from an Aggregated State
16	PDB:4d2qA	0.338	0.277	3.202E-11	789	0.115	0.093	4d2qA.pdb.gz
17	AFDB:P39955	0.239	0.178	6.220E-6	897	0.118	0.084	P39955.pdb.gz	SAP1_YEAST Protein SAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SAP1 PE=1 SV=1
18	AFDB:Q9Z1N2	0.250	0.193	1.097E-5	840	0.120	0.090	Q9Z1N2.pdb.gz	ORC1_MOUSE Origin recognition complex subunit 1 OS=Mus musculus OX=10090 GN=Orc1 PE=1 SV=2
19	AFDB:Q8BPY9	0.229	0.214	2.717E-5	683	0.131	0.122	Q8BPY9.pdb.gz	FIGL1_MOUSE Fidgetin-like protein 1 OS=Mus musculus OX=10090 GN=Fignl1 PE=1 SV=1
20	AFDB:Q2RBP2	0.218	0.135	8.444E-5	1131	0.136	0.076	Q2RBP2.pdb.gz	D53_ORYSJ Protein DWARF 53 OS=Oryza sativa subsp. japonica OX=39947 GN=D53 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4LID7	0.0	610	679	0.510	0.476	A0A0B4LID7_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=ClpX PE=1 SV=1
2	O76031	0.0	1300	633	1.000	1.000	CLPX_HUMAN ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Homo sapiens OX=9606 GN=CLPX PE=1 SV=2
3	Q66HW5	0.0	957	610	0.809	0.839	Q66HW5_DANRE ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Danio rerio OX=7955 GN=zgc:92303 PE=1 SV=1
4	Q9JHS4	0.0	1130	634	0.942	0.940	CLPX_MOUSE ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Mus musculus OX=10090 GN=Clpx PE=1 SV=2
5	Q9FK07	2.45e-104	330	579	0.278	0.304	CLPX1_ARATH CLP protease regulatory subunit CLPX1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=CLPX1 PE=2 SV=1
6	P0CAU2	7.21e-104	323	420	0.272	0.410	CLPX_CAUVC ATP-dependent Clp protease ATP-binding subunit ClpX OS=Caulobacter vibrioides (strain ATCC 19089 / CB15) OX=190650 GN=clpX PE=1 SV=1
7	P50866	3.60e-101	316	420	0.262	0.395	CLPX_BACSU ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus subtilis (strain 168) OX=224308 GN=clpX PE=2 SV=3
8	P0A6H1	4.98e-99	311	424	0.270	0.403	CLPX_ECOLI ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli (strain K12) OX=83333 GN=clpX PE=1 SV=2
9	P9WPB9	2.45e-96	304	426	0.270	0.401	CLPX_MYCTU ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=clpX PE=1 SV=1
10	P38323	1.07e-91	295	520	0.294	0.358	CLPX_YEAST ATP-dependent clpX-like chaperone, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MCX1 PE=1 SV=1
11	H0YK07	9.61e-87	268	130	0.205	1.000	H0YK07_HUMAN Caseinolytic mitochondrial matrix peptidase chaperone subunit X (Fragment) OS=Homo sapiens OX=9606 GN=CLPX PE=1 SV=1
12	P0A6H5	4.24e-15	80.5	443	0.120	0.172	HSLU_ECOLI ATP-dependent protease ATPase subunit HslU OS=Escherichia coli (strain K12) OX=83333 GN=hslU PE=1 SV=1
13	Q44772	7.90e-15	79.3	448	0.112	0.158	HSLU_BORBU ATP-dependent protease ATPase subunit HslU OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=hslU PE=3 SV=1
14	Q382V8	1.92e-09	62.8	496	0.060	0.077	HSLU2_TRYB2 ATP-dependent protease ATPase subunit HslU2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=HslU2 PE=3 SV=1
15	P43773	2.45e-09	62.4	444	0.058	0.083	HSLU_HAEIN ATP-dependent protease ATPase subunit HslU OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=hslU PE=1 SV=1
16	Q57VB1	7.68e-09	60.8	475	0.041	0.055	HSLU1_TRYB2 ATP-dependent protease ATPase subunit HslU1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=HslU1 PE=3 SV=1
17	Q9NC95	1.71e-06	53.1	408	0.058	0.091	Q9NC95_9TRYP Proteasome regulatory ATPase subunit 6 OS=Trypanosoma brucei OX=5691 GN=Rpt6 PE=3 SV=1
18	Q38A02	1.74e-06	53.1	408	0.058	0.091	Q38A02_TRYB2 Proteasome regulatory ATPase subunit 6 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.0580 PE=3 SV=1
19	F4KF14	6.41e-06	52.0	855	0.092	0.068	FTSI4_ARATH Probable inactive ATP-dependent zinc metalloprotease FTSHI 4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FTSHI4 PE=1 SV=1
20	P62195	1.35e-05	50.4	406	0.057	0.089	PRS8_HUMAN 26S proteasome regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMC5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	3.9e-10	51.7	ATPase family associated with various cellular activities (AAA)
2	PF13173 AAA_14	8.2	17.9	AAA domain
3	PF13191 AAA_16	5.7	18.8	AAA ATPase domain
4	PF13238 AAA_18	1.8e+02	14.1	AAA domain
5	PF07724 AAA_2	6.7e-38	142.0	AAA domain (Cdc48 subfamily)
6	PF13401 AAA_22	1	21.1	AAA domain
7	PF13479 AAA_24	3.4e+02	12.4	AAA domain
8	PF13555 AAA_29	4.1e+02	12.1	P-loop containing region of AAA domain
9	PF07728 AAA_5	0.045	25.2	AAA domain (dynein-related subfamily)
10	PF12775 AAA_7	0.22	22.5	P-loop containing dynein motor region
11	PF00005 ABC_tran	2.2e+02	13.8	ABC transporter
12	PF10431 ClpB_D2-small	2.1e-10	51.8	C-terminal, D2-small domain, of ClpB protein
13	PF01695 IstB_IS21	13	16.7	IstB-like ATP binding protein
14	PF00493 MCM	90	13.6	MCM P-loop domain
15	PF01078 Mg_chelatase	0.23	22.3	Magnesium chelatase, subunit ChlI
16	PF05729 NACHT	90	14.4	NACHT domain
17	PF10662 PduV-EutP	4.3e+02	12.1	Ethanolamine utilisation - propanediol utilisation
18	PF00910 RNA_helicase	6e+02	12.2	RNA helicase
19	PF05496 RuvB_N	19	16.5	Holliday junction DNA helicase RuvB P-loop domain
20	PF00158 Sigma54_activat	0.054	24.7	Sigma-54 interaction domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000300107

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000245816	0.999	ATP-dependent Clp protease proteolytic subunit, mitochondrial
2	9606.ENSP00000294053	0.954	Caseinolytic peptidase B protein homolog
3	9606.ENSP00000362390	0.951	T-box transcription factor TBX22
4	9606.ENSP00000353826	0.940	Lon protease homolog, mitochondrial
5	9606.ENSP00000318480	0.933	ATP-dependent zinc metalloprotease YME1L1
6	9606.ENSP00000264954	0.900	GrpE protein homolog 1, mitochondrial
7	9606.ENSP00000285737	0.895	Lon protease homolog 2, peroxisomal
8	9606.ENSP00000373620	0.874	60 kDa heat shock protein, mitochondrial
9	9606.ENSP00000256969	0.829	Spexin
10	9606.ENSP00000233893	0.817	10 kDa heat shock protein, mitochondrial
11	9606.ENSP00000269143	0.770	AFG3-like protein 2
12	9606.ENSP00000343023	0.714	Nuclear autoantigen Sp-100
13	9606.ENSP00000372088	0.698	DNA repair protein RAD51 homolog 1
14	9606.ENSP00000357980	0.696	Serine protease HTRA1
15	9606.ENSP00000320434	0.692	Alpha-catulin
16	9606.ENSP00000268704	0.690	Paraplegin
17	9606.ENSP00000483375	0.689	UDP-glucose 4-epimerase
18	9606.ENSP00000262375	0.684	DnaJ homolog subfamily A member 3, mitochondrial
19	9606.ENSP00000329558	0.673	GrpE protein homolog 2, mitochondrial
20	9606.ENSP00000378416	0.670	5-aminolevulinate synthase, nonspecific, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1901363	1.000	heterocyclic compound binding
GO:0097367	1.000	carbohydrate derivative binding
GO:0097159	1.000	organic cyclic compound binding
GO:0005515	1.000	protein binding
GO:0016887	1.000	ATP hydrolysis activity
GO:0036094	0.998	small molecule binding
GO:0043168	0.997	anion binding
GO:0005524	0.985	ATP binding
GO:0140096	0.947	catalytic activity, acting on a protein
GO:0008233	0.877	peptidase activity
GO:0098772	0.811	molecular function regulator activity
GO:0030234	0.777	enzyme regulator activity
GO:0004176	0.771	ATP-dependent peptidase activity
GO:0140677	0.726	molecular function activator activity
GO:0008047	0.702	enzyme activator activity
GO:0061134	0.665	peptidase regulator activity
GO:0016504	0.560	peptidase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0071704	0.990	organic substance metabolic process
GO:0044238	0.981	primary metabolic process
GO:0006807	0.980	nitrogen compound metabolic process
GO:0044237	0.934	cellular metabolic process
GO:1901564	0.925	organonitrogen compound metabolic process
GO:0043170	0.884	macromolecule metabolic process
GO:0019538	0.806	protein metabolic process
GO:0034641	0.776	cellular nitrogen compound metabolic process
GO:1901360	0.770	organic cyclic compound metabolic process
GO:0006725	0.746	cellular aromatic compound metabolic process
GO:0046483	0.742	heterocycle metabolic process
GO:0055086	0.729	nucleobase-containing small molecule metabolic process
GO:0006753	0.723	nucleoside phosphate metabolic process
GO:0009117	0.674	nucleotide metabolic process
GO:1901135	0.607	carbohydrate derivative metabolic process
GO:0072521	0.550	purine-containing compound metabolic process
GO:0019693	0.527	ribose phosphate metabolic process
GO:0050789	0.496	regulation of biological process
GO:0050794	0.448	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0005654	0.996	nucleoplasm
GO:0005829	0.994	cytosol
GO:0032991	0.978	protein-containing complex
GO:0016020	0.911	membrane
GO:0043228	0.847	non-membrane-bounded organelle
GO:0043232	0.827	intracellular non-membrane-bounded organelle
GO:0005759	0.755	mitochondrial matrix
GO:0031090	0.713	organelle membrane
GO:0031975	0.712	envelope
GO:0031967	0.657	organelle envelope
GO:0005740	0.653	mitochondrial envelope
GO:0031966	0.505	mitochondrial membrane
GO:0005743	0.464	mitochondrial inner membrane
GO:1902494	0.393	catalytic complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13065	1.000	ATP + H2O = ADP + H(+) + phosphate
EC:3.4.-.-	0.877	Acting on peptide bonds (peptidases).

[back to server]