StarFunc result for job id O76036

User Input

>input (304 residues)
MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQL
HFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEM
YDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPV
TTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTET
GLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLN
TQTL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O76036	1.000	1.000	6.393E-55	304	1.000	1.000	O76036.pdb.gz	NCTR1_HUMAN Natural cytotoxicity triggering receptor 1 OS=Homo sapiens OX=9606 GN=NCR1 PE=1 SV=1
2	AFDB:Q8C567	0.667	0.626	6.092E-39	325	0.612	0.572	Q8C567.pdb.gz	NCTR1_MOUSE Natural cytotoxicity triggering receptor 1 OS=Mus musculus OX=10090 GN=Ncr1 PE=1 SV=2
3	AFDB:A6NI73	0.626	0.636	1.085E-26	299	0.352	0.358	A6NI73.pdb.gz	LIRA5_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 5 OS=Homo sapiens OX=9606 GN=LILRA5 PE=1 SV=1
4	AFDB:Q8NHJ6	0.601	0.415	8.680E-26	448	0.368	0.250	Q8NHJ6.pdb.gz	LIRB4_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 4 OS=Homo sapiens OX=9606 GN=LILRB4 PE=1 SV=3
5	AFDB:P0C191	0.560	0.545	5.044E-25	313	0.329	0.319	P0C191.pdb.gz	GPVI_MOUSE Platelet glycoprotein VI OS=Mus musculus OX=10090 GN=Gp6 PE=1 SV=2
6	AFDB:Q9HCN6	0.581	0.524	3.439E-24	339	0.339	0.304	Q9HCN6.pdb.gz	GPVI_HUMAN Platelet glycoprotein VI OS=Homo sapiens OX=9606 GN=GP6 PE=1 SV=4
7	AFDB:Q64281	0.596	0.543	2.752E-23	335	0.293	0.266	Q64281.pdb.gz	LRB4A_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 4A OS=Mus musculus OX=10090 GN=Lilrb4a PE=1 SV=1
8	AFDB:Q61450	0.601	0.603	3.229E-23	303	0.296	0.297	Q61450.pdb.gz	LRB4B_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 4B OS=Mus musculus OX=10090 GN=Lilrb4b PE=1 SV=1
9	AFDB:Q28109	0.540	0.613	2.874E-22	264	0.372	0.428	Q28109.pdb.gz	Q28109_BOVIN FC gamma 2 receptor OS=Bos taurus OX=9913 PE=1 SV=1
10	AFDB:P43626	0.561	0.494	1.858E-21	348	0.306	0.267	P43626.pdb.gz	KI2L1_HUMAN Killer cell immunoglobulin-like receptor 2DL1 OS=Homo sapiens OX=9606 GN=KIR2DL1 PE=1 SV=1
11	PDB:5c6wJ	0.288	0.353	1.560E-6	238	0.072	0.092	5c6wJ.pdb.gz
12	PDB:6dlfA	0.241	0.300	5.609E-6	236	0.079	0.102	6dlfA.pdb.gz
13	PDB:6dldD	0.245	0.273	1.008E-5	269	0.109	0.123	6dldD.pdb.gz
14	PDB:1cf8L	0.242	0.322	1.064E-5	215	0.095	0.135	1cf8L.pdb.gz	Convergence of Catalytic Antibody and Terpene Cyclase Mechanisms: Polyene Cyclization Directed by Carbocation-pi Interactions
15	PDB:1e07A	0.276	0.150	1.248E-5	642	0.079	0.037	1e07A.pdb.gz
16	PDB:1f11A	0.256	0.344	1.545E-5	216	0.092	0.130	1f11A.pdb.gz
17	PDB:1ehlL	0.228	0.292	1.719E-5	217	0.089	0.124	1ehlL.pdb.gz	Crystal structure of the 64M-2 antibody Fab fragment in complex with a DNA dT(6-4)T photoproduct formed by ultraviolet radiation.
18	PDB:1l9mB	0.234	0.133	2.127E-5	681	0.092	0.041	1l9mB.pdb.gz	Three-dimensional structure of the human transglutaminase 3 enzyme: binding of calcium ions changes structure for activation.
19	PDB:4lluB	0.229	0.312	2.244E-5	210	0.076	0.110	4lluB.pdb.gz
20	PDB:1aifA	0.229	0.305	2.633E-5	215	0.086	0.121	1aifA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O76036	0.0	635	304	1.000	1.000	NCTR1_HUMAN Natural cytotoxicity triggering receptor 1 OS=Homo sapiens OX=9606 GN=NCR1 PE=1 SV=1
2	Q8C567	4.23e-139	397	325	0.612	0.572	NCTR1_MOUSE Natural cytotoxicity triggering receptor 1 OS=Mus musculus OX=10090 GN=Ncr1 PE=1 SV=2
3	A6NI73	7.35e-53	177	299	0.378	0.385	LIRA5_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 5 OS=Homo sapiens OX=9606 GN=LILRA5 PE=1 SV=1
4	Q8NHJ6	6.24e-52	178	448	0.332	0.225	LIRB4_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 4 OS=Homo sapiens OX=9606 GN=LILRB4 PE=1 SV=3
5	Q9HCN6	2.57e-49	169	339	0.368	0.330	GPVI_HUMAN Platelet glycoprotein VI OS=Homo sapiens OX=9606 GN=GP6 PE=1 SV=4
6	Q28109	3.73e-48	163	264	0.352	0.405	Q28109_BOVIN FC gamma 2 receptor OS=Bos taurus OX=9913 PE=1 SV=1
7	O75022	1.05e-45	165	631	0.316	0.152	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
8	P59901	1.07e-43	157	499	0.326	0.198	LIRA4_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 4 OS=Homo sapiens OX=9606 GN=LILRA4 PE=1 SV=3
9	P0C191	2.22e-43	152	313	0.349	0.339	GPVI_MOUSE Platelet glycoprotein VI OS=Mus musculus OX=10090 GN=Gp6 PE=1 SV=2
10	O75023	1.62e-38	145	590	0.303	0.156	LIRB5_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 5 OS=Homo sapiens OX=9606 GN=LILRB5 PE=1 SV=2
11	O75019	3.26e-38	142	489	0.293	0.182	LIRA1_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 1 OS=Homo sapiens OX=9606 GN=LILRA1 PE=2 SV=1
12	Q8N423	6.03e-37	140	597	0.283	0.144	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
13	Q61450	1.24e-36	134	303	0.273	0.274	LRB4B_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 4B OS=Mus musculus OX=10090 GN=Lilrb4b PE=1 SV=1
14	Q64281	2.05e-36	135	335	0.280	0.254	LRB4A_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 4A OS=Mus musculus OX=10090 GN=Lilrb4a PE=1 SV=1
15	Q8N6C8	2.75e-35	134	439	0.293	0.203	LIRA3_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 3 OS=Homo sapiens OX=9606 GN=LILRA3 PE=1 SV=3
16	Q8N149	7.33e-35	133	483	0.296	0.186	LIRA2_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 2 OS=Homo sapiens OX=9606 GN=LILRA2 PE=1 SV=3
17	Q99706	1.70e-34	130	377	0.316	0.255	KI2L4_HUMAN Killer cell immunoglobulin-like receptor 2DL4 OS=Homo sapiens OX=9606 GN=KIR2DL4 PE=1 SV=3
18	Q14954	9.93e-34	127	304	0.309	0.309	KI2S1_HUMAN Killer cell immunoglobulin-like receptor 2DS1 OS=Homo sapiens OX=9606 GN=KIR2DS1 PE=1 SV=2
19	P43631	6.13e-33	125	304	0.312	0.312	KI2S2_HUMAN Killer cell immunoglobulin-like receptor 2DS2 OS=Homo sapiens OX=9606 GN=KIR2DS2 PE=1 SV=2
20	Q8NHL6	7.96e-33	129	650	0.283	0.132	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18920 DUF5671	55	15.1	Domain of unknown function (DUF5671)
2	PF00047 ig	0.4	22.2	Immunoglobulin domain
3	PF13895 Ig_2	0.00036	32.1	Immunoglobulin domain
4	PF13927 Ig_3	8.7e-05	34.3	Immunoglobulin domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000291890

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354782	0.996	T-cell surface glycoprotein CD3 zeta chain
2	9606.ENSP00000289902	0.991	High affinity immunoglobulin epsilon receptor subunit gamma
3	9606.ENSP00000247153	0.975	Properdin
4	9606.ENSP00000480609	0.942	annotation not available
5	9606.ENSP00000240618	0.906	Killer cell lectin-like receptor subfamily K, member 1
6	9606.ENSP00000342156	0.906	Natural cytotoxicity triggering receptor 3
7	9606.ENSP00000362181	0.882	Natural cytotoxicity triggering receptor 2
8	9606.ENSP00000280200	0.871	CD226 antigen
9	9606.ENSP00000371333	0.870	Natural killer cells antigen CD94
10	9606.ENSP00000438038	0.867	NKG2-A/NKG2-B type II integral membrane protein
11	9606.ENSP00000480132	0.828	Neural cell adhesion molecule 1
12	9606.ENSP00000371327	0.818	NKG2-C type II integral membrane protein
13	9606.ENSP00000356946	0.804	Low affinity immunoglobulin gamma Fc region receptor III-A
14	9606.ENSP00000379191	0.779	CD59 glycoprotein
15	9606.ENSP00000398568	0.778	Perforin-1
16	9606.ENSP00000433642	0.775	Low affinity immunoglobulin gamma Fc region receptor III-B
17	9606.ENSP00000011653	0.751	T-cell surface glycoprotein CD4
18	9606.ENSP00000358165	0.749	High affinity immunoglobulin gamma Fc receptor I
19	9606.ENSP00000296545	0.738	Interleukin-15
20	9606.ENSP00000386559	0.726	T-cell surface glycoprotein CD8 alpha chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038023	0.698	signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0050794	0.994	regulation of cellular process
GO:0023052	0.986	signaling
GO:0007154	0.986	cell communication
GO:0006952	0.979	defense response
GO:0002682	0.979	regulation of immune system process
GO:0051716	0.960	cellular response to stimulus
GO:0050776	0.957	regulation of immune response
GO:0032101	0.952	regulation of response to external stimulus
GO:0007165	0.937	signal transduction
GO:0080134	0.934	regulation of response to stress
GO:0031347	0.920	regulation of defense response
GO:0048518	0.842	positive regulation of biological process
GO:0031341	0.840	regulation of cell killing
GO:0002697	0.812	regulation of immune effector process
GO:0002703	0.747	regulation of leukocyte mediated immunity
GO:0002706	0.630	regulation of lymphocyte mediated immunity
GO:0002831	0.620	regulation of response to biotic stimulus
GO:0002376	0.578	immune system process
GO:0045088	0.528	regulation of innate immune response
GO:0001910	0.514	regulation of leukocyte mediated cytotoxicity
GO:0048522	0.489	positive regulation of cellular process
GO:0019222	0.435	regulation of metabolic process
GO:0042269	0.419	regulation of natural killer cell mediated cytotoxicity
GO:0007166	0.386	cell surface receptor signaling pathway
GO:0060255	0.378	regulation of macromolecule metabolic process
GO:0032501	0.336	multicellular organismal process
GO:0006955	0.327	immune response
GO:0002684	0.313	positive regulation of immune system process
GO:0048519	0.310	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.997	plasma membrane
GO:0005622	0.748	intracellular anatomical structure
GO:0043226	0.628	organelle
GO:0043231	0.593	intracellular membrane-bounded organelle
GO:0009986	0.490	cell surface

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]