StarFunc result for job id O76041

User Input

>input (1014 residues)
MRVPVFEDIKDETEEEKIGEEENEEDQVFYKPVIEDLSMELARKCTELISDIRYKEEFKK
SKDKCTFVTDSPMLNHVKNIGAFISEAKYKGTIKADLSNSLYKRMPATIDSVFAGEVTQL
QSEVAYKQKHDAAKGFSDYAHMKEPPEVKHAMEVNKHQSNISYRKDVQDTHTYSAELDRP
DIKMATQISKIISNAEYKKGQGIMNKEPAVIGRPDFEHAVEASKLSSQIKYKEKFDNEMK
DKKHHYNPLESASFRQNQLAATLASNVKYKKDIQNMHDPVSDLPNLLFLDHVLKASKMLS
GREYKKLFEENKGMYHFDADAVEHLHHKGNAVLQSQVKYKEEYEKNKGKPMLEFVETPSY
QASKEAQKMQSEKVYKEDFEKEIKGRSSLDLDKTPEFLHVKYITNLLREKEYKKDLENEI
KGKGMELNSEVLDIQRAKRASEMASEKEYKKDLESIIKGKGMQAGTDTLEMQHAKKAAEI
ASEKDYKRDLETEIKGKGMQVSTDTLDVQRAKKASEMASQKQYKKDLENEIKGKGMQVSM
DIPDILRAKRTSEIYSQRKYKDEAEKMLSNYSTIADTPEIQRIKTTQQNISAVFYKKEVG
AGTAVKDSPEIERVKKNQQNISSVKYKEEIKHATAISDPPELKRVKENQKNISNLQYKEQ
NYKATPVSMTPEIERVRRNQEQLSAVKYKGELQRGTAISDPPELKRAKENQKNISNVYYR
GQLGRATTLSVTPEMERVKKNQENISSVKYTQDHKQMKGRPSLILDTPAMRHVKEAQNHI
SMVKYHEDFEKTKGRGFTPVVDDPVTERVRKNTQVVSDAAYKGVHPHIVEMDRRPGIIVD
LKVWRTDPGSIFDLDPLEDNIQSRSLHMLSEKASHYRRHWSRSHSSSTFGTGLGDDRSEI
SEIYPSFSCCSEVTRPSDEGAPVLPGAYQQSHSQGYGYMHQTSVSSMRSMQHSPNLRTYR
AMYDYSAQDEDEVSFRDGDYIVNVQPIDDGWMYGTVQRTGRTGMLPANYIEFVN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O76041	1.000	1.000	0.000	1014	1.000	1.000	O76041.pdb.gz	NEBL_HUMAN Nebulette OS=Homo sapiens OX=9606 GN=NEBL PE=1 SV=1
2	AFDB:Q9DEG5	0.081	0.080	6.253E-22	1042	0.207	0.202	Q9DEG5.pdb.gz	Q9DEG5_CHICK Nebulin (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
3	AFDB:B0UY60	0.083	0.197	1.017E-18	387	0.168	0.439	B0UY60.pdb.gz
4	AFDB:Q80XB4	0.088	0.058	7.767E-18	1728	0.201	0.118	Q80XB4.pdb.gz	NRAP_MOUSE Nebulin-related-anchoring protein OS=Mus musculus OX=10090 GN=Nrap PE=1 SV=3
5	AFDB:Q86VF7	0.081	0.059	4.821E-16	1730	0.221	0.129	Q86VF7.pdb.gz	NRAP_HUMAN Nebulin-related-anchoring protein OS=Homo sapiens OX=9606 GN=NRAP PE=1 SV=2
6	AFDB:Q61792	0.064	0.236	6.977E-16	263	0.084	0.323	Q61792.pdb.gz	LASP1_MOUSE LIM and SH3 domain protein 1 OS=Mus musculus OX=10090 GN=Lasp1 PE=1 SV=1
7	AFDB:Q8I7C3	0.058	0.090	7.839E-13	657	0.117	0.181	Q8I7C3.pdb.gz	LASP1_DROME LIM and SH3 domain protein Lasp OS=Drosophila melanogaster OX=7227 GN=Lasp PE=1 SV=2
8	AFDB:A0A1B0GSF5	0.066	0.116	1.003E-12	529	0.117	0.225	A0A1B0GSF5.pdb.gz	A0A1B0GSF5_MOUSE Nebulin (Fragment) OS=Mus musculus OX=10090 GN=Neb PE=1 SV=1
9	AFDB:Q66HL2	0.063	0.111	3.161E-11	509	0.081	0.161	Q66HL2.pdb.gz	SRC8_RAT Src substrate cortactin OS=Rattus norvegicus OX=10116 GN=Cttn PE=1 SV=1
10	AFDB:P15891	0.059	0.099	7.042E-11	592	0.070	0.120	P15891.pdb.gz	ABP1_YEAST Actin-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ABP1 PE=1 SV=4
11	PDB:3ehqA	0.054	0.287	4.150E-6	182	0.019	0.104	3ehqA.pdb.gz
12	PDB:1griA	0.057	0.267	4.879E-5	211	0.021	0.100	1griA.pdb.gz
13	PDB:6x5hA	0.057	0.122	7.988E-5	467	0.017	0.036	6x5hA.pdb.gz	Characterizing human alpha-1,6-fucosyltransferase (FUT8) substrate specificity and structural similarities with related fucosyltransferases.
14	PDB:2dybA	0.055	0.184	1.022E-4	298	0.016	0.054	2dybA.pdb.gz
15	PDB:1k0xA	0.055	0.459	3.505E-4	108	0.012	0.111	1k0xA.pdb.gz
16	PDB:1k9aB	0.053	0.121	3.728E-4	441	0.015	0.034	1k9aB.pdb.gz
17	PDB:2h8hA	0.048	0.108	5.073E-4	445	0.017	0.038	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
18	PDB:3qwyA	0.057	0.326	6.903E-4	170	0.012	0.071	3qwyA.pdb.gz
19	PDB:2eyzA	0.055	0.179	1.538E-3	304	0.015	0.049	2eyzA.pdb.gz
20	PDB:4mt6A	0.049	0.125	2.367E-3	389	0.013	0.033	4mt6A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5Y690	0.0	774	7364	0.454	0.062	A0A8I5Y690_RAT Nebulin OS=Rattus norvegicus OX=10116 GN=Neb PE=1 SV=1
2	A0A8I5Y9I7	0.0	605	7426	0.413	0.056	A0A8I5Y9I7_RAT Nebulin OS=Rattus norvegicus OX=10116 GN=Neb PE=1 SV=1
3	A0A8I5ZQE8	0.0	758	7395	0.459	0.063	A0A8I5ZQE8_RAT Nebulin OS=Rattus norvegicus OX=10116 GN=Neb PE=1 SV=1
4	A0A8I6A8Q0	0.0	745	7302	0.446	0.062	A0A8I6A8Q0_RAT Nebulin OS=Rattus norvegicus OX=10116 GN=Neb PE=1 SV=1
5	A0A8I6ASW0	0.0	775	7364	0.453	0.062	A0A8I6ASW0_RAT Nebulin OS=Rattus norvegicus OX=10116 GN=Neb PE=1 SV=1
6	A0A8I6G5A2	0.0	736	7257	0.447	0.062	A0A8I6G5A2_RAT Nebulin OS=Rattus norvegicus OX=10116 GN=Neb PE=1 SV=1
7	A2AQA9	0.0	769	6909	0.452	0.066	A2AQA9_MOUSE Nebulin OS=Mus musculus OX=10090 GN=Neb PE=1 SV=1
8	A2AQB2	0.0	754	3044	0.444	0.148	A2AQB2_MOUSE Nebulin OS=Mus musculus OX=10090 GN=Neb PE=1 SV=1
9	E9Q1W3	0.0	766	7152	0.457	0.065	E9Q1W3_MOUSE Nebulin OS=Mus musculus OX=10090 GN=Neb PE=1 SV=1
10	F1M1J2	0.0	597	7457	0.415	0.056	F1M1J2_RAT Nebulin OS=Rattus norvegicus OX=10116 GN=Neb PE=1 SV=4
11	G1TDU6	0.0	770	6666	0.457	0.069	G1TDU6_RABIT Nebulin OS=Oryctolagus cuniculus OX=9986 GN=NEB PE=4 SV=2
12	O76041	0.0	2103	1014	1.000	1.000	NEBL_HUMAN Nebulette OS=Homo sapiens OX=9606 GN=NEBL PE=1 SV=1
13	P20929	0.0	776	6669	0.461	0.070	NEBU_HUMAN Nebulin OS=Homo sapiens OX=9606 GN=NEB PE=1 SV=5
14	A0A8I5ZRN3	1.09e-180	586	7523	0.416	0.056	A0A8I5ZRN3_RAT Nebulin OS=Rattus norvegicus OX=10116 GN=Neb PE=1 SV=1
15	A0A096MK15	1.43e-180	586	7488	0.414	0.056	A0A096MK15_RAT Nebulin OS=Rattus norvegicus OX=10116 GN=Neb PE=1 SV=2
16	A0A571BF46	6.35e-168	549	7488	0.346	0.047	A0A571BF46_MOUSE Nebulin OS=Mus musculus OX=10090 GN=Neb PE=1 SV=1
17	A0A571BF58	6.54e-168	549	7523	0.346	0.047	A0A571BF58_MOUSE Nebulin OS=Mus musculus OX=10090 GN=Neb PE=1 SV=1
18	F6X9B6	1.73e-155	481	768	0.314	0.414	F6X9B6_MOUSE Nebulin (Fragment) OS=Mus musculus OX=10090 GN=Neb PE=1 SV=1
19	Q9DEH4	1.02e-153	506	2402	0.386	0.163	Q9DEH4_CHICK Nebulin (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=2
20	Q90684	3.44e-152	458	380	0.239	0.637	Q90684_CHICK Nebulette (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00880 Nebulin	1.8e-125	418.3	Nebulin repeat
2	PF01433 Peptidase_M1	2.1e+02	12.9	Peptidase family M1 domain
3	PF00018 SH3_1	1.8e-08	45.2	SH3 domain
4	PF07653 SH3_2	0.084	24.0	Variant SH3 domain
5	PF14604 SH3_9	2.5e-12	57.9	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000366326

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000324422	0.987	Zyxin
2	9606.ENSP00000351790	0.917	Myopalladin
3	9606.ENSP00000386840	0.793	Xin actin-binding repeat-containing protein 2
4	9606.ENSP00000467141	0.766	Titin
5	9606.ENSP00000352565	0.764	Heart- and neural crest derivatives-expressed protein 2
6	9606.ENSP00000443495	0.687	Alpha-actinin-2
7	9606.ENSP00000327145	0.654	Filamin-C
8	9606.ENSP00000366460	0.619	Plexin domain-containing protein 2
9	9606.ENSP00000312624	0.617	Telethonin
10	9606.ENSP00000241051	0.607	DEP domain containing 7
11	9606.ENSP00000284509	0.604	Probable phospholipid-transporting ATPase IM
12	9606.ENSP00000267085	0.599	Catalyzes the decarboxylation of L-aspartate, 3-sulfino-L- alanine (cysteine sulfinic acid), and L-cysteate to beta-alanine, hypotaurine and taurine, respectively. The preferred substrate is 3- sulfino-L-alanine. Does not exhibit any decarboxylation activity toward glutamate
13	9606.ENSP00000366487	0.599	ADP-ribosylation factor-like protein 5B
14	9606.ENSP00000211998	0.584	Vinculin
15	9606.ENSP00000295087	0.583	ADP-ribosylation factor-like protein 5A
16	9606.ENSP00000320025	0.580	Voltage-dependent L-type calcium channel subunit beta-2
17	9606.ENSP00000259365	0.577	Tropomodulin-1
18	9606.ENSP00000431813	0.570	Cysteine and glycine-rich protein 3
19	9606.ENSP00000258538	0.546	Solute carrier family 41 member 2
20	9606.ENSP00000401437	0.539	LIM domain-binding protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008092	0.991	cytoskeletal protein binding
GO:0003779	0.942	actin binding
GO:0044877	0.932	protein-containing complex binding
GO:0051015	0.924	actin filament binding
GO:0005523	0.916	tropomyosin binding
GO:0031005	0.900	filamin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0048856	0.957	anatomical structure development
GO:0006996	0.942	organelle organization
GO:0009653	0.940	anatomical structure morphogenesis
GO:0030029	0.928	actin filament-based process
GO:0061061	0.928	muscle structure development
GO:0048468	0.923	cell development
GO:0022607	0.920	cellular component assembly
GO:0032501	0.917	multicellular organismal process
GO:0007010	0.915	cytoskeleton organization
GO:0030036	0.913	actin cytoskeleton organization
GO:0010927	0.910	cellular component assembly involved in morphogenesis
GO:0030239	0.899	myofibril assembly
GO:0007275	0.856	multicellular organism development
GO:0065007	0.797	biological regulation
GO:0048513	0.780	animal organ development
GO:0007507	0.773	heart development
GO:0060537	0.739	muscle tissue development
GO:0048738	0.710	cardiac muscle tissue development
GO:0050789	0.624	regulation of biological process
GO:0050794	0.543	regulation of cellular process
GO:0055007	0.540	cardiac muscle cell differentiation
GO:0055006	0.539	cardiac cell development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030016	1.000	myofibril
GO:0043227	0.991	membrane-bounded organelle
GO:0015629	0.990	actin cytoskeleton
GO:0030017	0.990	sarcomere
GO:0005829	0.941	cytosol
GO:0031674	0.931	I band
GO:0030018	0.895	Z disc
GO:0043231	0.780	intracellular membrane-bounded organelle
GO:0031982	0.745	vesicle
GO:0005576	0.580	extracellular region
GO:1903561	0.489	extracellular vesicle
GO:0070062	0.472	extracellular exosome
GO:0097517	0.445	contractile actin filament bundle
GO:0001725	0.432	stress fiber

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]