StarFunc result for job id O76064

User Input

>input (485 residues)
MGEPGFFVTGDRAGGRSWCLRRVGMSAGWLLLEDGCEVTVGRGFGVTYQLVSKICPLMIS
RNHCVLKQNPEGQWTIMDNKSLNGVWLNRARLEPLRVYSIHQGDYIQLGVPLENKENAEY
EYEVTEEDWETIYPCLSPKNDQMIEKNKELRTKRKFSLDELAGPGAEGPSNLKSKINKVS
CESGQPVKSQGKGEVASTPSDNLDPKLTALEPSKTTGAPIYPGFPKVTEVHHEQKASNSS
ASQRSLQMFKVTMSRILRLKIQMQEKHEAVMNVKKQTQKGNSKKVVQMEQELQDLQSQLC
AEQAQQQARVEQLEKTFQEEEQHLQGLEIAQGEKDLKQQLAQALQEHWALMEELNRSKKD
FEAIIQAKNKELEQTKEEKEKMQAQKEEVLSHMNDVLENELQCIICSEYFIEAVTLNCAH
SFCSYCINEWMKRKIECPICRKDIKSKTYSLVLDNCINKMVNNLSSEVKERRIVLIRERK
AKRLF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O76064	1.000	1.000	1.170E-79	485	1.000	1.000	O76064.pdb.gz	RNF8_HUMAN E3 ubiquitin-protein ligase RNF8 OS=Homo sapiens OX=9606 GN=RNF8 PE=1 SV=1
2	AFDB:Q8VC56	0.373	0.371	2.916E-59	488	0.713	0.709	Q8VC56.pdb.gz	RNF8_MOUSE E3 ubiquitin-protein ligase RNF8 OS=Mus musculus OX=10090 GN=Rnf8 PE=1 SV=1
3	AFDB:Q5FWP4	0.202	0.159	1.435E-11	625	0.163	0.126	Q5FWP4.pdb.gz	CHFR_XENLA E3 ubiquitin-protein ligase CHFR OS=Xenopus laevis OX=8355 GN=chfr PE=1 SV=1
4	AFDB:Q57XM6	0.200	0.251	1.853E-8	383	0.095	0.120	Q57XM6.pdb.gz	Q57XM6_TRYB2 Peptidyl-prolyl cis-trans isomerase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.22O10.530 PE=1 SV=1
5	AFDB:Q99KJ5	0.213	0.378	3.706E-8	263	0.082	0.152	Q99KJ5.pdb.gz	TCF19_MOUSE Transcription factor 19-like protein OS=Mus musculus OX=10090 GN=Tcf19 PE=2 SV=1
6	AFDB:Q5SW79	0.202	0.064	6.603E-8	1584	0.082	0.025	Q5SW79.pdb.gz	CE170_HUMAN Centrosomal protein of 170 kDa OS=Homo sapiens OX=9606 GN=CEP170 PE=1 SV=1
7	AFDB:D2IYK5	0.212	0.293	1.247E-7	345	0.087	0.122	D2IYK5.pdb.gz	D2IYK5_HUMAN TCF19 OS=Homo sapiens OX=9606 GN=TCF19 PE=1 SV=1
8	AFDB:Q6A065	0.205	0.065	1.399E-7	1588	0.074	0.023	Q6A065.pdb.gz	CE170_MOUSE Centrosomal protein of 170 kDa OS=Mus musculus OX=10090 GN=Cep170 PE=1 SV=2
9	PDB:7dvqX	0.189	0.557	2.035E-7	156	0.054	0.167	7dvqX.pdb.gz	Structure of the activated human minor spliceosome.
10	AFDB:Q9Y4F5	0.201	0.063	3.958E-7	1589	0.080	0.025	Q9Y4F5.pdb.gz	C170B_HUMAN Centrosomal protein of 170 kDa protein B OS=Homo sapiens OX=9606 GN=CEP170B PE=1 SV=4
11	PDB:2ff4A	0.181	0.230	1.537E-6	379	0.043	0.055	2ff4A.pdb.gz	Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
12	PDB:5gm6U	0.195	0.485	1.096E-5	176	0.064	0.176	5gm6U.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
13	PDB:5z56X	0.195	0.549	3.310E-4	159	0.041	0.126	5z56X.pdb.gz	Structure of the human activated spliceosome in three conformational states.
14	PDB:5gm6a	0.126	0.454	6.249E-4	123	0.045	0.179	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
15	AFDB:A1Z8Q9	0.186	0.206	1.288E-3	431	0.060	0.067	A1Z8Q9.pdb.gz	A1Z8Q9_DROME FI01543p OS=Drosophila melanogaster OX=7227 GN=reb PE=2 SV=1
16	PDB:7wrgB	0.168	0.107	1.403E-3	783	0.035	0.022	7wrgB.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
17	PDB:6l9wD	0.171	0.516	1.669E-3	142	0.045	0.155	6l9wD.pdb.gz
18	PDB:4r8pL	0.137	0.256	2.973E-3	254	0.049	0.094	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
19	PDB:5dkaA	0.117	0.517	3.536E-3	96	0.037	0.188	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
20	PDB:7wrgA	0.156	0.096	5.000E-3	812	0.033	0.020	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O76064	0.0	1003	485	1.000	1.000	RNF8_HUMAN E3 ubiquitin-protein ligase RNF8 OS=Homo sapiens OX=9606 GN=RNF8 PE=1 SV=1
2	Q8VC56	0.0	686	488	0.713	0.709	RNF8_MOUSE E3 ubiquitin-protein ligase RNF8 OS=Mus musculus OX=10090 GN=Rnf8 PE=1 SV=1
3	C9J858	2.25e-151	431	205	0.423	1.000	C9J858_HUMAN Ring finger protein 8 (Fragment) OS=Homo sapiens OX=9606 GN=RNF8 PE=1 SV=1
4	O74747	9.16e-09	59.7	387	0.039	0.049	RAD18_SCHPO Postreplication repair E3 ubiquitin-protein ligase rad18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rhp18 PE=3 SV=1
5	Q810L3	2.82e-07	55.5	664	0.091	0.066	CHFR_MOUSE E3 ubiquitin-protein ligase CHFR OS=Mus musculus OX=10090 GN=Chfr PE=1 SV=1
6	Q96EP1	5.01e-07	54.7	664	0.066	0.048	CHFR_HUMAN E3 ubiquitin-protein ligase CHFR OS=Homo sapiens OX=9606 GN=CHFR PE=1 SV=2
7	Q5FWP4	8.34e-07	53.9	625	0.056	0.043	CHFR_XENLA E3 ubiquitin-protein ligase CHFR OS=Xenopus laevis OX=8355 GN=chfr PE=1 SV=1
8	P29128	8.71e-07	53.9	676	0.039	0.028	ICP0_BHV1J E3 ubiquitin-protein ligase ICP0 OS=Bovine herpesvirus 1.1 (strain Jura) OX=31518 GN=BICP0 PE=1 SV=1
9	K4P3M7	9.14e-07	53.9	683	0.039	0.028	K4P3M7_9ALPH Immediate-early transactivator protein with Zn finger (Cell nucleus) OS=Bovine herpesvirus type 1.1 OX=79889 GN=BICP0 PE=1 SV=1
10	A0A024RCP5	1.02e-06	53.5	518	0.054	0.050	A0A024RCP5_HUMAN TRIM39 OS=Homo sapiens OX=9606 PE=4 SV=1
11	Q9HCM9	1.02e-06	53.5	518	0.054	0.050	TRI39_HUMAN E3 ubiquitin-protein ligase TRIM39 OS=Homo sapiens OX=9606 GN=TRIM39 PE=1 SV=2
12	P25916	1.06e-06	52.8	324	0.064	0.096	BMI1_MOUSE Polycomb complex protein BMI-1 OS=Mus musculus OX=10090 GN=Bmi1 PE=1 SV=1
13	A2AAZ6	1.14e-06	52.4	260	0.043	0.081	A2AAZ6_HUMAN E3 ubiquitin-protein ligase TRIM39 (Fragment) OS=Homo sapiens OX=9606 GN=TRIM39 PE=4 SV=8
14	Q21610	1.19e-06	53.5	627	0.068	0.053	Q21610_CAEEL Par-2 protein OS=Caenorhabditis elegans OX=6239 GN=par-2 PE=2 SV=1
15	Q9W0D7	1.28e-06	52.4	299	0.062	0.100	Q9W0D7_DROME GM14467p OS=Drosophila melanogaster OX=7227 GN=Pex10 PE=2 SV=1
16	P35226	1.31e-06	52.8	326	0.064	0.095	BMI1_HUMAN Polycomb complex protein BMI-1 OS=Homo sapiens OX=9606 GN=BMI1 PE=1 SV=2
17	A0A096LP39	1.37e-06	53.1	503	0.043	0.042	A0A096LP39_HUMAN Ribonuclease P protein subunit p21 OS=Homo sapiens OX=9606 GN=TRIM39-RPP21 PE=1 SV=1
18	R4GMX3	1.46e-06	52.8	469	0.064	0.066	R4GMX3_HUMAN COMMD3-BMI1 readthrough OS=Homo sapiens OX=9606 GN=COMMD3-BMI1 PE=4 SV=1
19	Q496Y0	1.53e-06	53.1	759	0.060	0.038	LONF3_HUMAN LON peptidase N-terminal domain and RING finger protein 3 OS=Homo sapiens OX=9606 GN=LONRF3 PE=1 SV=1
20	Q7T3E6	1.63e-06	52.4	324	0.064	0.096	BMI1B_DANRE Polycomb complex protein BMI-1-B OS=Danio rerio OX=7955 GN=bmi1b PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00498 FHA	2.6e-10	51.8	FHA domain
2	PF13611 Peptidase_S76	6.2e+02	12.1	Serine peptidase of plant viral polyprotein, P1
3	PF14447 Prok-RING_4	0.093	23.9	Prokaryotic RING finger family 4
4	PF12861 zf-ANAPC11	14	17.2	Anaphase-promoting complex subunit 11 RING-H2 finger
5	PF00097 zf-C3HC4	1e-05	36.6	Zinc finger, C3HC4 type (RING finger)
6	PF13923 zf-C3HC4_2	8.3e-06	36.8	Zinc finger, C3HC4 type (RING finger)
7	PF13920 zf-C3HC4_3	9.1e-07	39.9	Zinc finger, C3HC4 type (RING finger)
8	PF15227 zf-C3HC4_4	0.0081	27.6	zinc finger of C3HC4-type, RING
9	PF12678 zf-rbx1	0.054	25.1	RING-H2 zinc finger domain
10	PF16685 zf-RING_10	38	15.8	zinc RING finger of MSL2
11	PF13639 zf-RING_2	0.00011	33.8	Ring finger domain
12	PF14570 zf-RING_4	1.2e+02	13.9	RING/Ubox like zinc-binding domain
13	PF14634 zf-RING_5	0.0096	27.2	zinc-RING finger domain
14	PF14835 zf-RING_6	16	16.8	zf-RING of BARD1-type protein
15	PF13445 zf-RING_UBOX	0.029	25.7	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362578

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000316176	0.999	Ubiquitin-conjugating enzyme E2 N
2	9606.ENSP00000365588	0.999	Mediator of DNA damage checkpoint protein 1
3	9606.ENSP00000371475	0.997	TP53-binding protein 1
4	9606.ENSP00000434024	0.994	Histone H2AX
5	9606.ENSP00000320898	0.993	E3 ubiquitin-protein ligase RNF168
6	9606.ENSP00000418960	0.993	Breast cancer type 1 susceptibility protein
7	9606.ENSP00000278616	0.991	Serine-protein kinase ATM
8	9606.ENSP00000366434	0.991	BRCA1-A complex subunit RAP80
9	9606.ENSP00000265433	0.982	Nibrin
10	9606.ENSP00000261609	0.974	E3 ubiquitin-protein ligase HERC2
11	9606.ENSP00000441543	0.972	Polyubiquitin-C
12	9606.ENSP00000369857	0.970	BRCA1-A complex subunit Abraxas 1
13	9606.ENSP00000372023	0.969	Serine/threonine-protein kinase Chk2
14	9606.ENSP00000382628	0.968	DNA endonuclease RBBP8
15	9606.ENSP00000349508	0.963	Chromodomain-helicase-DNA-binding protein 4
16	9606.ENSP00000426503	0.955	E3 ubiquitin-protein ligase RNF4
17	9606.ENSP00000349722	0.946	Ubiquitin conjugating enzyme E2 D3
18	9606.ENSP00000325863	0.943	Double-strand break repair protein MRE11
19	9606.ENSP00000348056	0.943	SUMO-conjugating enzyme UBC9
20	9606.ENSP00000368100	0.936	DNA repair protein RAD50

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042393	0.997	histone binding
GO:0004842	0.997	ubiquitin-protein transferase activity
GO:0003682	0.985	chromatin binding
GO:0019899	0.956	enzyme binding
GO:0042802	0.954	identical protein binding
GO:0031625	0.926	ubiquitin protein ligase binding
GO:0043169	0.915	cation binding
GO:0046872	0.914	metal ion binding
GO:0008270	0.902	zinc ion binding
GO:0042803	0.888	protein homodimerization activity
GO:0003676	0.539	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.997	primary metabolic process
GO:0050896	0.996	response to stimulus
GO:0044237	0.996	cellular metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0043170	0.995	macromolecule metabolic process
GO:0006950	0.992	response to stress
GO:0051716	0.991	cellular response to stimulus
GO:0044260	0.991	cellular macromolecule metabolic process
GO:0019538	0.989	protein metabolic process
GO:0050789	0.986	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0080134	0.977	regulation of response to stress
GO:0033554	0.970	cellular response to stress
GO:0051052	0.960	regulation of DNA metabolic process
GO:0043412	0.958	macromolecule modification
GO:0010604	0.956	positive regulation of macromolecule metabolic process
GO:2001020	0.955	regulation of response to DNA damage stimulus
GO:0048522	0.952	positive regulation of cellular process
GO:0006974	0.948	cellular response to DNA damage stimulus
GO:0051173	0.947	positive regulation of nitrogen compound metabolic process
GO:0036211	0.947	protein modification process
GO:0034641	0.945	cellular nitrogen compound metabolic process
GO:0031325	0.943	positive regulation of cellular metabolic process
GO:0006259	0.939	DNA metabolic process
GO:0045935	0.930	positive regulation of nucleobase-containing compound metabolic process
GO:0006281	0.925	DNA repair
GO:0006302	0.922	double-strand break repair
GO:0048519	0.906	negative regulation of biological process
GO:0016570	0.904	histone modification
GO:0010556	0.887	regulation of macromolecule biosynthetic process
GO:0016574	0.887	histone ubiquitination
GO:0031326	0.886	regulation of cellular biosynthetic process
GO:0010468	0.885	regulation of gene expression
GO:0048523	0.876	negative regulation of cellular process
GO:0048584	0.843	positive regulation of response to stimulus
GO:0006282	0.810	regulation of DNA repair
GO:0006355	0.807	regulation of DNA-templated transcription
GO:0051054	0.691	positive regulation of DNA metabolic process
GO:0045934	0.654	negative regulation of nucleobase-containing compound metabolic process
GO:0010605	0.623	negative regulation of macromolecule metabolic process
GO:0071840	0.506	cellular component organization or biogenesis
GO:0016043	0.459	cellular component organization
GO:2001022	0.444	positive regulation of response to DNA damage stimulus
GO:0045739	0.432	positive regulation of DNA repair
GO:0000209	0.424	protein polyubiquitination
GO:0009314	0.359	response to radiation
GO:0006508	0.349	proteolysis
GO:0070534	0.306	protein K63-linked ubiquitination
GO:0006310	0.303	DNA recombination
GO:0010212	0.302	response to ionizing radiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005694	1.000	chromosome
GO:0005654	0.998	nucleoplasm
GO:0005829	0.992	cytosol
GO:0032991	0.991	protein-containing complex
GO:1902494	0.923	catalytic complex
GO:0140535	0.837	intracellular protein-containing complex
GO:0098687	0.771	chromosomal region
GO:1990234	0.741	transferase complex
GO:0090734	0.725	site of DNA damage
GO:0000151	0.719	ubiquitin ligase complex
GO:0035861	0.652	site of double-strand break
GO:0000781	0.344	chromosome, telomeric region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.997	Transferases.

[back to server]