StarFunc result for job id O76071

User Input

>input (339 residues)
MKDSLVLLGRVPAHPDSRCWFLAWNPAGTLLASCGGDRRIRIWGTEGDSWICKSVLSEGH
QRTVRKVAWSPCGNYLASASFDATTCIWKKNQDDFECVTTLEGHENEVKSVAWAPSGNLL
ATCSRDKSVWVWEVDEEDEYECVSVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYREE
EDDWVCCATLEGHESTVWSLAFDPSGQRLASCSDDRTVRIWRQYLPGNEQGVACSGSDPS
WKCICTLSGFHSRTIYDIAWCQLTGALATACGDDAIRVFQEDPNSDPQQPTFSLTAHLHQ
AHSQDVNCVAWNPKEPGLLASCSDDGEVAFWKYQRPEGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O76071	1.000	1.000	3.655E-67	339	1.000	1.000	O76071.pdb.gz	CIAO1_HUMAN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens OX=9606 GN=CIAO1 PE=1 SV=1
2	PDB:3fm0A	0.962	0.995	5.991E-58	328	0.965	0.997	3fm0A.pdb.gz
3	AFDB:Q7K1Y4	0.961	0.973	6.092E-46	335	0.575	0.582	Q7K1Y4.pdb.gz	CIAO1_DROME Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila melanogaster OX=7227 GN=Ciao1 PE=1 SV=1
4	PDB:6tblF	0.960	0.969	5.253E-45	336	0.575	0.580	6tblF.pdb.gz
5	AFDB:O80990	0.914	0.881	1.546E-39	352	0.475	0.457	O80990.pdb.gz	CIA1_ARATH Protein CIA1 OS=Arabidopsis thaliana OX=3702 GN=CIA1 PE=1 SV=2
6	AFDB:Q9XW12	0.898	0.903	7.200E-34	337	0.392	0.395	Q9XW12.pdb.gz	CIAO1_CAEEL Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Caenorhabditis elegans OX=6239 GN=Y18D10A.9 PE=1 SV=2
7	AFDB:Q9UT57	0.895	0.505	2.495E-32	608	0.366	0.204	Q9UT57.pdb.gz	CFD1_SCHPO Probable cytosolic Fe-S cluster assembly factor SPAC806.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC806.02c PE=3 SV=1
8	AFDB:Q05583	0.881	0.904	2.180E-30	330	0.392	0.403	Q05583.pdb.gz	CIAO1_YEAST Cytosolic iron-sulfur protein assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CIA1 PE=1 SV=1
9	PDB:2hesX	0.856	0.940	2.864E-28	308	0.378	0.416	2hesX.pdb.gz
10	AFDB:Q581A6	0.843	0.679	8.537E-27	424	0.395	0.316	Q581A6.pdb.gz	Q581A6_TRYB2 Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.10J17.390 PE=3 SV=1
11	AFDB:Q9UUG8	0.792	0.464	1.409E-22	598	0.271	0.154	Q9UUG8.pdb.gz	TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tup12 PE=1 SV=2
12	AFDB:Q8I0F4	0.772	0.630	2.635E-21	419	0.257	0.208	Q8I0F4.pdb.gz	LIS1_DICDI Lissencephaly-1 homolog OS=Dictyostelium discoideum OX=44689 GN=lis1 PE=1 SV=1
13	AFDB:Q585M8	0.817	0.634	5.997E-21	442	0.233	0.179	Q585M8.pdb.gz	Q585M8_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.28P18.830 PE=4 SV=1
14	PDB:5nnzA	0.706	0.714	9.581E-20	335	0.251	0.254	5nnzA.pdb.gz
15	PDB:2h9lA	0.789	0.832	2.677E-19	321	0.257	0.271	2h9lA.pdb.gz
16	PDB:1vyhC	0.783	0.853	3.124E-19	310	0.236	0.258	1vyhC.pdb.gz
17	PDB:7pzyh	0.789	0.856	4.476E-19	311	0.251	0.273	7pzyh.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
18	PDB:5mzhB	0.716	0.598	1.536E-18	415	0.236	0.193	5mzhB.pdb.gz
19	PDB:7bt6x	0.676	0.488	2.846E-18	488	0.248	0.172	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
20	PDB:5a2qg	0.797	0.858	2.996E-18	314	0.212	0.229	5a2qg.pdb.gz	Cryo-Em Structure of Hepatitis C Virus Ires Bound to the Human Ribosome at 3.9 Angstrom Resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O76071	0.0	697	339	1.000	1.000	CIAO1_HUMAN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens OX=9606 GN=CIAO1 PE=1 SV=1
2	Q99KN2	0.0	668	339	0.950	0.950	CIAO1_MOUSE Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus OX=10090 GN=Ciao1 PE=1 SV=1
3	Q7K1Y4	6.77e-146	416	335	0.575	0.582	CIAO1_DROME Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila melanogaster OX=7227 GN=Ciao1 PE=1 SV=1
4	O80990	2.48e-103	309	352	0.493	0.474	CIA1_ARATH Protein CIA1 OS=Arabidopsis thaliana OX=3702 GN=CIA1 PE=1 SV=2
5	Q05583	2.89e-77	241	330	0.395	0.406	CIAO1_YEAST Cytosolic iron-sulfur protein assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CIA1 PE=1 SV=1
6	Q9XW12	1.62e-74	235	337	0.383	0.386	CIAO1_CAEEL Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Caenorhabditis elegans OX=6239 GN=Y18D10A.9 PE=1 SV=2
7	Q9UT57	1.07e-66	222	608	0.366	0.204	CFD1_SCHPO Probable cytosolic Fe-S cluster assembly factor SPAC806.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC806.02c PE=3 SV=1
8	Q581A6	1.23e-59	199	424	0.404	0.323	Q581A6_TRYB2 Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.10J17.390 PE=3 SV=1
9	Q8BHJ5	3.03e-30	122	514	0.245	0.161	TBL1R_MOUSE F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus OX=10090 GN=Tbl1xr1 PE=1 SV=1
10	Q9BZK7	3.16e-30	122	514	0.245	0.161	TBL1R_HUMAN F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens OX=9606 GN=TBL1XR1 PE=1 SV=1
11	Q9QXE7	8.55e-30	121	527	0.257	0.165	TBL1X_MOUSE F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus OX=10090 GN=Tbl1x PE=1 SV=2
12	Q9BQ87	1.15e-29	120	522	0.257	0.167	TBL1Y_HUMAN F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens OX=9606 GN=TBL1Y PE=1 SV=1
13	O60907	1.79e-29	120	577	0.257	0.151	TBL1X_HUMAN F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens OX=9606 GN=TBL1X PE=1 SV=3
14	Q95RJ9	4.16e-28	117	700	0.248	0.120	EBI_DROME F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster OX=7227 GN=ebi PE=1 SV=2
15	Q9FN19	3.02e-26	111	613	0.257	0.142	HOS15_ARATH WD40 repeat-containing protein HOS15 OS=Arabidopsis thaliana OX=3702 GN=HOS15 PE=2 SV=1
16	Q9VU65	6.08e-26	108	391	0.236	0.205	POC1_DROME POC1 centriolar protein homolog OS=Drosophila melanogaster OX=7227 GN=Poc1 PE=2 SV=1
17	Q7KNS3	3.61e-25	107	411	0.236	0.195	LIS1_DROME Lissencephaly-1 homolog OS=Drosophila melanogaster OX=7227 GN=Lis-1 PE=1 SV=2
18	Q803D2	1.97e-24	104	410	0.236	0.195	LIS1B_DANRE Lissencephaly-1 homolog B OS=Danio rerio OX=7955 GN=pafah1b1b PE=2 SV=3
19	Q8I0F4	1.43e-23	102	419	0.180	0.146	LIS1_DICDI Lissencephaly-1 homolog OS=Dictyostelium discoideum OX=44689 GN=lis1 PE=1 SV=1
20	P43034	2.34e-23	101	410	0.168	0.139	LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit beta OS=Homo sapiens OX=9606 GN=PAFAH1B1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	1.7e-18	78.0	Anaphase-promoting complex subunit 4 WD40 domain
2	PF04053 Coatomer_WDAD	0.27	21.9	Coatomer WD associated region
3	PF08662 eIF2A	0.0013	30.1	Eukaryotic translation initiation factor eIF2A
4	PF16529 Ge1_WD40	0.074	23.6	WD40 region of Ge1, enhancer of mRNA-decapping protein
5	PF04762 IKI3	0.013	25.2	IKI3 family
6	PF20426 NBCH_WD40	0.00037	31.1	Neurobeachin beta propeller domain
7	PF00400 WD40	6e-44	158.4	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000006109

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000013052	0.991	Family with sequence similarity 96, member B
2	9555.ENSPANP00000020786	0.991	MMS19 homolog, cytosolic iron-sulfur assembly component
3	9555.ENSPANP00000014121	0.979	Family with sequence similarity 96, member A
4	9555.ENSPANP00000013503	0.944	Nuclear prelamin A recognition factor-like
5	9555.ENSPANP00000013893	0.884	Component of the cytosolic iron-sulfur (Fe/S) protein assembly (CIA) machinery. Required for maturation of extramitochondrial Fe-S proteins. The NUBP1-NUBP2 heterotetramer forms a Fe-S scaffold complex, mediating the de novo assembly of an Fe-S cluster and its transfer to target apoproteins. Implicated in the regulation of centrosome duplication
6	9555.ENSPANP00000016413	0.865	Nuclear prelamin A recognition factor
7	9555.ENSPANP00000014810	0.857	Protein phosphatase 1, regulatory subunit 13 like
8	9555.ENSPANP00000013633	0.823	Component of the cytosolic iron-sulfur (Fe/S) protein assembly (CIA) machinery. Required for maturation of extramitochondrial Fe-S proteins. The NUBP1-NUBP2 heterotetramer forms a Fe-S scaffold complex, mediating the de novo assembly of an Fe-S cluster and its transfer to target apoproteins
9	9555.ENSPANP00000020452	0.804	DNA replication helicase/nuclease 2
10	9555.ENSPANP00000014415	0.802	ATP-dependent DNA helicase implicated in telomere-length regulation, DNA repair and the maintenance of genomic stability. Acts as an anti-recombinase to counteract toxic recombination and limit crossover during meiosis. Regulates meiotic recombination and crossover homeostasis by physically dissociating strand invasion events and thereby promotes noncrossover repair by meiotic synthesis dependent strand annealing (SDSA) as well as disassembly of D loop recombination intermediates. Also disassembles T loops and prevents telomere fragility by counteracting telomeric G4-DNA structures, wh [...]
11	9555.ENSPANP00000009876	0.790	Polymerase (DNA directed), epsilon, catalytic subunit
12	9555.ENSPANP00000014051	0.788	Leo1, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae)
13	9555.ENSPANP00000008432	0.782	Polymerase (DNA directed), delta 1, catalytic subunit
14	9555.ENSPANP00000020408	0.777	BRCA1 interacting protein C-terminal helicase 1
15	9555.ENSPANP00000001196	0.740	Nucleotide binding protein-like
16	9555.ENSPANP00000018486	0.721	F-box and leucine-rich repeat protein 5
17	9555.ENSPANP00000013746	0.651	CDK5 regulatory subunit associated protein 1-like 1
18	9555.ENSPANP00000020915	0.636	Golgi brefeldin A resistant guanine nucleotide exchange factor 1
19	9555.ENSPANP00000013616	0.635	PAK1 interacting protein 1
20	9555.ENSPANP00000012871	0.624	Component of the cytosolic iron-sulfur (Fe-S) protein assembly (CIA) machinery required for the maturation of extramitochondrial Fe-S proteins. Part of an electron transfer chain functioning in an early step of cytosolic Fe-S biogenesis, facilitating the de novo assembly of a [4Fe-4S] cluster on the scaffold complex NUBP1-NUBP2. Electrons are transferred to CIAPIN1 from NADPH via the FAD- and FMN-containing protein NDOR1. NDOR1-CIAPIN1 are also required for the assembly of the diferric tyrosyl radical cofactor of ribonucleotide reductase (RNR), probably by providing electrons for reduc [...]

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140110	0.572	transcription regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050794	0.975	regulation of cellular process
GO:0044237	0.911	cellular metabolic process
GO:0019222	0.816	regulation of metabolic process
GO:0031323	0.804	regulation of cellular metabolic process
GO:0080090	0.802	regulation of primary metabolic process
GO:0051171	0.801	regulation of nitrogen compound metabolic process
GO:0060255	0.784	regulation of macromolecule metabolic process
GO:0019219	0.782	regulation of nucleobase-containing compound metabolic process
GO:0071704	0.699	organic substance metabolic process
GO:2001141	0.699	regulation of RNA biosynthetic process
GO:0006355	0.690	regulation of DNA-templated transcription
GO:0071840	0.683	cellular component organization or biogenesis
GO:0044238	0.673	primary metabolic process
GO:0006807	0.646	nitrogen compound metabolic process
GO:0016043	0.625	cellular component organization
GO:0043170	0.599	macromolecule metabolic process
GO:0006357	0.569	regulation of transcription by RNA polymerase II
GO:0044085	0.568	cellular component biogenesis
GO:0022607	0.467	cellular component assembly
GO:0031163	0.426	metallo-sulfur cluster assembly
GO:0016226	0.422	iron-sulfur cluster assembly
GO:0010467	0.320	gene expression
GO:0048518	0.319	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005737	1.000	cytoplasm
GO:0043229	1.000	intracellular organelle
GO:0140535	0.993	intracellular protein-containing complex
GO:0043232	0.959	intracellular non-membrane-bounded organelle
GO:0043231	0.953	intracellular membrane-bounded organelle
GO:0005634	0.941	nucleus
GO:0005856	0.863	cytoskeleton
GO:0005829	0.788	cytosol
GO:0015630	0.738	microtubule cytoskeleton
GO:0005819	0.603	spindle
GO:0043233	0.331	organelle lumen
GO:0031981	0.322	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]