StarFunc result for job id O76074

User Input

>input (875 residues)
MERAGPSFGQQRQQQQPQQQKQQQRDQDSVEAWLDDHWDFTFSYFVRKATREMVNAWFAE
RVHTIPVCKEGIRGHTESCSCPLQQSPRADNSAPGTPTRKISASEFDRPLRPIVVKDSEG
TVSFLSDSEKKEQMPLTPPRFDHDEGDQCSRLLELVKDISSHLDVTALCHKIFLHIHGLI
SADRYSLFLVCEDSSNDKFLISRLFDVAEGSTLEEVSNNCIRLEWNKGIVGHVAALGEPL
NIKDAYEDPRFNAEVDQITGYKTQSILCMPIKNHREEVVGVAQAINKKSGNGGTFTEKDE
KDFAAYLAFCGIVLHNAQLYETSLLENKRNQVLLDLASLIFEEQQSLEVILKKIAATIIS
FMQVQKCTIFIVDEDCSDSFSSVFHMECEELEKSSDTLTREHDANKINYMYAQYVKNTME
PLNIPDVSKDKRFPWTTENTGNVNQQCIRSLLCTPIKNGKKNKVIGVCQLVNKMEENTGK
VKPFNRNDEQFLEAFVIFCGLGIQNTQMYEAVERAMAKQMVTLEVLSYHASAAEEETREL
QSLAAAVVPSAQTLKITDFSFSDFELSDLETALCTIRMFTDLNLVQNFQMKHEVLCRWIL
SVKKNYRKNVAYHNWRHAFNTAQCMFAALKAGKIQNKLTDLEILALLIAALSHDLDHRGV
NNSYIQRSEHPLAQLYCHSIMEHHHFDQCLMILNSPGNQILSGLSIEEYKTTLKIIKQAI
LATDLALYIKRRGEFFELIRKNQFNLEDPHQKELFLAMLMTACDLSAITKPWPIQQRIAE
LVATEFFDQGDRERKELNIEPTDLMNREKKNKIPSMQVGFIDAICLQLYEALTHVSEDCF
PLLDGCRKNRQKWQALAEQQEKMLINGESGQAKRN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O76074	1.000	1.000	0.000	875	1.000	1.000	O76074.pdb.gz	PDE5A_HUMAN cGMP-specific 3',5'-cyclic phosphodiesterase OS=Homo sapiens OX=9606 GN=PDE5A PE=1 SV=2
2	AFDB:Q9VJ79	0.722	0.446	5.471E-70	1451	0.470	0.283	Q9VJ79.pdb.gz	PDE11_DROME Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11 OS=Drosophila melanogaster OX=7227 GN=Pde11 PE=1 SV=4
3	AFDB:Q8VID6	0.760	0.714	3.266E-66	935	0.402	0.376	Q8VID6.pdb.gz	PDE11_RAT Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A OS=Rattus norvegicus OX=10116 GN=Pde11a PE=1 SV=1
4	AFDB:Q9VFI9	0.708	0.563	1.511E-64	1118	0.400	0.313	Q9VFI9.pdb.gz	PDE6_DROME cGMP-specific 3',5'-cyclic phosphodiesterase OS=Drosophila melanogaster OX=7227 GN=Pde6 PE=1 SV=4
5	AFDB:D3ZDI8	0.617	0.630	6.483E-51	856	0.285	0.291	D3ZDI8.pdb.gz	D3ZDI8_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde6b PE=3 SV=1
6	AFDB:A0A0R4IUY2	0.620	0.635	8.608E-50	852	0.272	0.279	A0A0R4IUY2.pdb.gz
7	AFDB:P16499	0.602	0.611	2.296E-49	860	0.279	0.284	P16499.pdb.gz	PDE6A_HUMAN Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha OS=Homo sapiens OX=9606 GN=PDE6A PE=1 SV=4
8	AFDB:P51160	0.585	0.595	4.286E-49	858	0.298	0.304	P51160.pdb.gz	PDE6C_HUMAN Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha' OS=Homo sapiens OX=9606 GN=PDE6C PE=1 SV=2
9	AFDB:Q91ZQ1	0.384	0.389	9.717E-48	861	0.280	0.285	Q91ZQ1.pdb.gz	PDE6C_MOUSE Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha' OS=Mus musculus OX=10090 GN=Pde6c PE=2 SV=1
10	PDB:7jsnA	0.604	0.639	6.956E-46	820	0.272	0.290	7jsnA.pdb.gz	Structure of the Visual Signaling Complex between Transducin and Phosphodiesterase 6.
11	PDB:6mzbB	0.600	0.643	1.855E-45	807	0.287	0.311	6mzbB.pdb.gz	Cryo-EM structure of phosphodiesterase 6 reveals insights into the allosteric regulation of type I phosphodiesterases.
12	AFDB:Q9QYJ6	0.614	0.669	1.066E-44	794	0.269	0.296	Q9QYJ6.pdb.gz	PDE10_RAT cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A OS=Rattus norvegicus OX=10116 GN=Pde10a PE=1 SV=1
13	PDB:3bjcA	0.342	0.942	4.115E-37	311	0.351	0.987	3bjcA.pdb.gz	An insight into the pharmacophores of phosphodiesterase-5 inhibitors from synthetic and crystal structural studies
14	PDB:4y86B	0.354	0.932	2.986E-18	326	0.104	0.279	4y86B.pdb.gz	Structural Asymmetry of Phosphodiesterase-9A and a Unique Pocket for Selective Binding of a Potent Enantiomeric Inhibitor.
15	PDB:1f5mB	0.147	0.606	5.022E-5	177	0.031	0.153	1f5mB.pdb.gz
16	PDB:1vhmB	0.149	0.680	9.803E-5	160	0.033	0.181	1vhmB.pdb.gz
17	PDB:7rzwB	0.247	0.249	1.464E-4	864	0.039	0.039	7rzwB.pdb.gz	Plant phytochrome B is an asymmetric dimer with unique signalling potential.
18	PDB:4zmuA	0.140	0.314	7.745E-3	341	0.038	0.097	4zmuA.pdb.gz
19	PDB:5loeA	0.167	0.483	8.854E-3	258	0.037	0.124	5loeA.pdb.gz	Structure of the Branched-chain Amino Acid and GTP-sensing Global Regulator, CodY, from Bacillus subtilis.
20	PDB:2w1tA	0.120	0.491	1.107E-2	175	0.032	0.160	2w1tA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O54735	0.0	1617	833	0.882	0.927	PDE5A_RAT cGMP-specific 3',5'-cyclic phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde5a PE=2 SV=1
2	O76074	0.0	1831	875	1.000	1.000	PDE5A_HUMAN cGMP-specific 3',5'-cyclic phosphodiesterase OS=Homo sapiens OX=9606 GN=PDE5A PE=1 SV=2
3	Q8CG03	0.0	1684	865	0.925	0.935	PDE5A_MOUSE cGMP-specific 3',5'-cyclic phosphodiesterase OS=Mus musculus OX=10090 GN=Pde5a PE=1 SV=2
4	Q8VID6	0.0	621	935	0.368	0.344	PDE11_RAT Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A OS=Rattus norvegicus OX=10116 GN=Pde11a PE=1 SV=1
5	Q9HCR9	0.0	617	933	0.368	0.345	PDE11_HUMAN Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A OS=Homo sapiens OX=9606 GN=PDE11A PE=1 SV=2
6	Q9VFI9	0.0	646	1118	0.390	0.305	PDE6_DROME cGMP-specific 3',5'-cyclic phosphodiesterase OS=Drosophila melanogaster OX=7227 GN=Pde6 PE=1 SV=4
7	Q9VJ79	0.0	695	1451	0.418	0.252	PDE11_DROME Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11 OS=Drosophila melanogaster OX=7227 GN=Pde11 PE=1 SV=4
8	P35913	5.43e-129	410	854	0.291	0.299	PDE6B_HUMAN Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta OS=Homo sapiens OX=9606 GN=PDE6B PE=1 SV=2
9	P23439	2.72e-127	405	853	0.295	0.302	PDE6B_BOVIN Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta OS=Bos taurus OX=9913 GN=PDE6B PE=1 SV=1
10	P23440	2.43e-126	403	856	0.294	0.300	PDE6B_MOUSE Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta OS=Mus musculus OX=10090 GN=Pde6b PE=2 SV=3
11	D3ZDI8	1.93e-125	400	856	0.293	0.299	D3ZDI8_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde6b PE=3 SV=1
12	P16499	9.65e-124	396	860	0.290	0.295	PDE6A_HUMAN Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha OS=Homo sapiens OX=9606 GN=PDE6A PE=1 SV=4
13	Q91ZQ1	1.15e-122	393	861	0.295	0.300	PDE6C_MOUSE Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha' OS=Mus musculus OX=10090 GN=Pde6c PE=2 SV=1
14	P11541	8.15e-122	391	859	0.281	0.286	PDE6A_BOVIN Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha OS=Bos taurus OX=9913 GN=PDE6A PE=1 SV=3
15	P27664	5.32e-121	389	859	0.279	0.284	PDE6A_MOUSE Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha OS=Mus musculus OX=10090 GN=Pde6a PE=2 SV=3
16	Q6P4P8	8.64e-120	385	852	0.278	0.285	Q6P4P8_DANRE Phosphodiesterase OS=Danio rerio OX=7955 GN=zgc:73085 PE=1 SV=1
17	P51160	2.21e-119	384	858	0.278	0.283	PDE6C_HUMAN Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha' OS=Homo sapiens OX=9606 GN=PDE6C PE=1 SV=2
18	Q9QYJ6	2.56e-106	348	794	0.248	0.273	PDE10_RAT cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A OS=Rattus norvegicus OX=10116 GN=Pde10a PE=1 SV=1
19	Q9Y233	3.32e-106	347	779	0.245	0.275	PDE10_HUMAN cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A OS=Homo sapiens OX=9606 GN=PDE10A PE=1 SV=1
20	Q8CA95	4.12e-106	347	790	0.248	0.275	PDE10_MOUSE cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A OS=Mus musculus OX=10090 GN=Pde10a PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01590 GAF	1.4e-28	111.6	GAF domain
2	PF13185 GAF_2	4e-05	35.4	GAF domain
3	PF01966 HD	2.2e+02	13.5	HD domain
4	PF00233 PDEase_I	1.2e-69	246.2	3'5'-cyclic nucleotide phosphodiesterase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347046

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000387123	0.906	Alpha-aminoadipic semialdehyde dehydrogenase
2	9606.ENSP00000363092	0.902	cGMP-dependent protein kinase 1
3	9606.ENSP00000359719	0.881	cAMP-dependent protein kinase catalytic subunit beta
4	9606.ENSP00000309591	0.880	cAMP-dependent protein kinase catalytic subunit alpha
5	9606.ENSP00000366488	0.880	cAMP-dependent protein kinase catalytic subunit gamma
6	9606.ENSP00000357669	0.870	Atrial natriuretic peptide receptor 1
7	9606.ENSP00000261170	0.862	Heat-stable enterotoxin receptor
8	9606.ENSP00000341083	0.856	Atrial natriuretic peptide receptor 2
9	9606.ENSP00000296518	0.832	Guanylate cyclase 1, soluble, alpha 3
10	9606.ENSP00000264424	0.829	Guanylate cyclase soluble subunit beta-1
11	9606.ENSP00000218006	0.810	Retinal guanylyl cyclase 2
12	9606.ENSP00000356825	0.806	Adenylate cyclase type 10
13	9606.ENSP00000311405	0.804	Adenylate cyclase type 6
14	9606.ENSP00000282249	0.800	Guanylate cyclase soluble subunit alpha-2
15	9606.ENSP00000419361	0.798	Adenylate cyclase type 5
16	9606.ENSP00000294016	0.793	Adenylate cyclase type 9
17	9606.ENSP00000286355	0.788	Adenylate cyclase type 8
18	9606.ENSP00000254854	0.784	Retinal guanylyl cyclase 1
19	9606.ENSP00000378187	0.771	Adenylate cyclase type 7
20	9606.ENSP00000287600	0.770	Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0047555	1.000	3',5'-cyclic-GMP phosphodiesterase activity
GO:0030553	1.000	cGMP binding
GO:0005515	0.997	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.988	regulation of biological process
GO:0050794	0.983	regulation of cellular process
GO:0048583	0.981	regulation of response to stimulus
GO:0032501	0.979	multicellular organismal process
GO:0009987	0.978	cellular process
GO:0048522	0.960	positive regulation of cellular process
GO:0044237	0.957	cellular metabolic process
GO:0071704	0.935	organic substance metabolic process
GO:0044238	0.934	primary metabolic process
GO:0003008	0.934	system process
GO:0050896	0.929	response to stimulus
GO:0048856	0.893	anatomical structure development
GO:0006807	0.878	nitrogen compound metabolic process
GO:0048519	0.877	negative regulation of biological process
GO:0051239	0.875	regulation of multicellular organismal process
GO:0009117	0.859	nucleotide metabolic process
GO:0072521	0.857	purine-containing compound metabolic process
GO:0048523	0.851	negative regulation of cellular process
GO:0023051	0.849	regulation of signaling
GO:0010646	0.849	regulation of cell communication
GO:0019222	0.844	regulation of metabolic process
GO:0051716	0.833	cellular response to stimulus
GO:0009966	0.816	regulation of signal transduction
GO:0048584	0.792	positive regulation of response to stimulus
GO:0006163	0.770	purine nucleotide metabolic process
GO:0090257	0.766	regulation of muscle system process
GO:0009187	0.764	cyclic nucleotide metabolic process
GO:0007154	0.751	cell communication
GO:0023052	0.741	signaling
GO:1902531	0.739	regulation of intracellular signal transduction
GO:0051241	0.735	negative regulation of multicellular organismal process
GO:0007165	0.733	signal transduction
GO:0002682	0.704	regulation of immune system process
GO:0051240	0.687	positive regulation of multicellular organismal process
GO:0042127	0.683	regulation of cell population proliferation
GO:0048585	0.585	negative regulation of response to stimulus
GO:0065008	0.532	regulation of biological quality
GO:0030154	0.526	cell differentiation
GO:0060255	0.484	regulation of macromolecule metabolic process
GO:1901292	0.480	nucleoside phosphate catabolic process
GO:0052652	0.455	cyclic purine nucleotide metabolic process
GO:1901135	0.441	carbohydrate derivative metabolic process
GO:0031323	0.428	regulation of cellular metabolic process
GO:0009166	0.413	nucleotide catabolic process
GO:0014743	0.406	regulation of muscle hypertrophy
GO:0009259	0.386	ribonucleotide metabolic process
GO:0072523	0.383	purine-containing compound catabolic process
GO:1903522	0.372	regulation of blood circulation
GO:0006195	0.369	purine nucleotide catabolic process
GO:0023057	0.362	negative regulation of signaling
GO:0010648	0.361	negative regulation of cell communication
GO:0009150	0.348	purine ribonucleotide metabolic process
GO:0009968	0.346	negative regulation of signal transduction
GO:0042221	0.328	response to chemical
GO:1902532	0.323	negative regulation of intracellular signal transduction
GO:0080090	0.312	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:16957	1.000	3',5'-cyclic GMP + H2O = GMP + H(+)
EC:3.1.4.35	1.000	3',5'-cyclic-GMP phosphodiesterase.

[back to server]