StarFunc result for job id O76075

User Input

>input (338 residues)
MLQKPKSVKLRALRSPRKFGVAGRSCQEVLRKGCLRFQLPERGSRLCLYEDGTELTEDYF
PSVPDNAELVLLTLGQAWQGYVSDIRRFLSAFHEPQVGLIQAAQQLLCDEQAPQRQRLLA
DLLHNVSQNIAAETRAEDPPWFEGLESRFQSKSGYLRYSCESRIRSYLREVSSYPSTVGA
EAQEEFLRVLGSMCQRLRSMQYNGSYFDRGAKGGSRLCTPEGWFSCQGPFDMDSCLSRHS
INPYSNRESRILFSTWNLDHIIEKKRTIIPTLVEAIKEQDGREVDWEYFYGLLFTSENLK
LVHIVCHKKTTHKLNCDPSRIYKPQTRLKRKQPVRKRQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O76075	1.000	1.000	5.098E-69	338	1.000	1.000	O76075.pdb.gz	DFFB_HUMAN DNA fragmentation factor subunit beta OS=Homo sapiens OX=9606 GN=DFFB PE=1 SV=1
2	AFDB:B4DZS0	0.758	0.709	3.817E-65	362	0.997	0.931	B4DZS0.pdb.gz	B4DZS0_HUMAN DNA fragmentation factor subunit beta OS=Homo sapiens OX=9606 GN=DFFB PE=1 SV=1
3	AFDB:Q99N34	0.958	0.928	6.819E-57	349	0.760	0.736	Q99N34.pdb.gz	DFFB_RAT DNA fragmentation factor subunit beta OS=Rattus norvegicus OX=10116 GN=Dffb PE=1 SV=1
4	PDB:1v0dA	0.705	0.972	2.669E-36	244	0.580	0.803	1v0dA.pdb.gz	Structural Mechanism for Inactivation and Activation of Cad/Dff40 in the Apoptotic Pathway
5	AFDB:Q9NDR2	0.546	0.415	9.969E-23	450	0.275	0.207	Q9NDR2.pdb.gz	Q9NDR2_DROME Caspase-activated DNase OS=Drosophila melanogaster OX=7227 GN=Drep4 PE=2 SV=1
6	AFDB:O54786	0.231	0.235	1.013E-5	331	0.112	0.115	O54786.pdb.gz	DFFA_MOUSE DNA fragmentation factor subunit alpha OS=Mus musculus OX=10090 GN=Dffa PE=1 SV=2
7	AFDB:Q0E9B7	0.239	0.299	1.353E-5	266	0.077	0.098	Q0E9B7.pdb.gz	Q0E9B7_DROME DNAation factor-related protein 3, isoform A OS=Drosophila melanogaster OX=7227 GN=Drep3 PE=1 SV=1
8	AFDB:O00273	0.235	0.239	2.280E-5	331	0.109	0.112	O00273.pdb.gz	DFFA_HUMAN DNA fragmentation factor subunit alpha OS=Homo sapiens OX=9606 GN=DFFA PE=1 SV=1
9	AFDB:Q8N5P9	0.224	0.297	3.046E-5	253	0.062	0.083	Q8N5P9.pdb.gz	Q8N5P9_HUMAN Cell death activator CIDE-A variant 2 OS=Homo sapiens OX=9606 GN=CIDEA PE=1 SV=1
10	AFDB:Q9UHD4	0.216	0.331	3.840E-5	219	0.062	0.096	Q9UHD4.pdb.gz	CIDEB_HUMAN Lipid transferase CIDEB OS=Homo sapiens OX=9606 GN=CIDEB PE=1 SV=2
11	AFDB:O70302	0.224	0.344	4.069E-5	217	0.062	0.097	O70302.pdb.gz	CIDEA_MOUSE Lipid transferase CIDEA OS=Mus musculus OX=10090 GN=Cidea PE=1 SV=2
12	PDB:3tixA	0.169	0.338	1.436E-3	153	0.050	0.111	3tixA.pdb.gz
13	PDB:6yvaC	0.184	0.374	1.613E-3	155	0.030	0.065	6yvaC.pdb.gz
14	PDB:6mdhA	0.175	0.368	4.317E-3	149	0.033	0.074	6mdhA.pdb.gz
15	PDB:4im0A	0.162	0.095	4.575E-3	619	0.086	0.047	4im0A.pdb.gz	Structure and ubiquitination-dependent activation of TANK-binding kinase 1.
16	PDB:5ia8A	0.180	0.589	5.443E-3	92	0.038	0.141	5ia8A.pdb.gz
17	PDB:7rbsB	0.182	0.367	5.768E-3	157	0.024	0.051	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
18	PDB:3pgeA	0.180	0.326	6.476E-3	172	0.033	0.064	3pgeA.pdb.gz
19	PDB:5xqmA	0.180	0.593	6.476E-3	90	0.027	0.100	5xqmA.pdb.gz
20	PDB:3dbhI	0.183	0.619	6.863E-3	86	0.024	0.093	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B4DZS0	0.0	681	362	0.997	0.931	B4DZS0_HUMAN DNA fragmentation factor subunit beta OS=Homo sapiens OX=9606 GN=DFFB PE=1 SV=1
2	O54788	0.0	555	344	0.772	0.759	DFFB_MOUSE DNA fragmentation factor subunit beta OS=Mus musculus OX=10090 GN=Dffb PE=1 SV=1
3	O76075	0.0	701	338	1.000	1.000	DFFB_HUMAN DNA fragmentation factor subunit beta OS=Homo sapiens OX=9606 GN=DFFB PE=1 SV=1
4	Q99N34	0.0	535	349	0.743	0.719	DFFB_RAT DNA fragmentation factor subunit beta OS=Rattus norvegicus OX=10116 GN=Dffb PE=1 SV=1
5	Q9V3H0	7.03e-25	106	450	0.305	0.229	Q9V3H0_DROME DNAation factor-related protein 4 OS=Drosophila melanogaster OX=7227 GN=Drep4 PE=1 SV=1
6	Q9NDR2	7.98e-25	106	450	0.305	0.229	Q9NDR2_DROME Caspase-activated DNase OS=Drosophila melanogaster OX=7227 GN=Drep4 PE=2 SV=1
7	O60543	0.019	38.5	219	0.071	0.110	CIDEA_HUMAN Lipid transferase CIDEA OS=Homo sapiens OX=9606 GN=CIDEA PE=1 SV=1
8	O70302	0.023	38.1	217	0.071	0.111	CIDEA_MOUSE Lipid transferase CIDEA OS=Mus musculus OX=10090 GN=Cidea PE=1 SV=2
9	Q498U6	0.057	37.4	265	0.080	0.102	Q498U6_RAT DNA fragmentation factor subunit alpha OS=Rattus norvegicus OX=10116 GN=Dffa PE=1 SV=1
10	Q96AQ7	0.071	36.6	238	0.089	0.126	CIDEC_HUMAN Lipid transferase CIDEC OS=Homo sapiens OX=9606 GN=CIDEC PE=1 SV=1
11	Q8N5P9	0.075	36.6	253	0.071	0.095	Q8N5P9_HUMAN Cell death activator CIDE-A variant 2 OS=Homo sapiens OX=9606 GN=CIDEA PE=1 SV=1
12	P56198	0.13	35.8	239	0.056	0.079	CIDEC_MOUSE Lipid transferase CIDEC OS=Mus musculus OX=10090 GN=Cidec PE=1 SV=2
13	O54786	0.25	35.4	331	0.071	0.073	DFFA_MOUSE DNA fragmentation factor subunit alpha OS=Mus musculus OX=10090 GN=Dffa PE=1 SV=2
14	O61464	0.39	34.7	299	0.065	0.074	O61464_DROME DNAation factor DREP-1 OS=Drosophila melanogaster OX=7227 GN=Drep1 PE=1 SV=1
15	O70303	0.43	34.3	219	0.077	0.119	CIDEB_MOUSE Lipid transferase CIDEB OS=Mus musculus OX=10090 GN=Cideb PE=1 SV=2
16	Q6NR36	0.45	34.7	297	0.065	0.074	Q6NR36_DROME DNAation factor-related protein 1, isoform A OS=Drosophila melanogaster OX=7227 GN=Drep1 PE=2 SV=1
17	A0A0B4KFQ3	0.50	34.3	306	0.065	0.072	A0A0B4KFQ3_DROME DNAation factor-related protein 1, isoform B OS=Drosophila melanogaster OX=7227 GN=Drep1 PE=4 SV=1
18	O00273	0.77	33.9	331	0.092	0.094	DFFA_HUMAN DNA fragmentation factor subunit alpha OS=Homo sapiens OX=9606 GN=DFFA PE=1 SV=1
19	Q0E9B7	1.0	33.5	266	0.077	0.098	Q0E9B7_DROME DNAation factor-related protein 3, isoform A OS=Drosophila melanogaster OX=7227 GN=Drep3 PE=1 SV=1
20	Q57U33	1.5	33.1	556	0.068	0.041	Q57U33_TRYB2 Proline dehydrogenase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.8P12.290 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02017 CIDE-N	2.1e-18	77.4	CIDE-N domain
2	PF09230 DFF40	1.4e-93	324.2	DNA fragmentation factor 40 kDa
3	PF00557 Peptidase_M24	7.1e+02	11.3	Metallopeptidase family M24

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000339524

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000366237	0.999	DNA fragmentation factor subunit alpha
2	9606.ENSP00000311032	0.977	Caspase-3
3	9606.ENSP00000344504	0.971	Histone H1.0
4	9606.ENSP00000337731	0.928	Cell death activator CIDE-B
5	9606.ENSP00000345347	0.910	High mobility group protein B1
6	9606.ENSP00000296503	0.904	High mobility group protein B2
7	9606.ENSP00000319799	0.904	Histone H1oo
8	9606.ENSP00000329662	0.903	Histone H1x
9	9606.ENSP00000320209	0.823	Cell death activator CIDE-A
10	9606.ENSP00000373328	0.808	Cell death activator CIDE-3
11	9606.ENSP00000262710	0.775	Apoptotic chromatin condensation inducer in the nucleus
12	9606.ENSP00000361725	0.750	Endonuclease G, mitochondrial
13	9606.ENSP00000244534	0.733	Histone H1.3
14	9606.ENSP00000330074	0.721	Histone H1.5
15	9606.ENSP00000244573	0.718	Histone H1.1
16	9606.ENSP00000222219	0.705	Deoxyribonuclease-2-alpha
17	9606.ENSP00000351908	0.691	Mitogen-activated protein kinase kinase kinase 5
18	9606.ENSP00000360525	0.688	Protein mago nashi homolog
19	9606.ENSP00000448165	0.688	Apoptotic protease-activating factor 1
20	9606.ENSP00000330237	0.681	Caspase-9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004536	1.000	deoxyribonuclease activity
GO:0019904	0.999	protein domain specific binding
GO:0019899	0.994	enzyme binding
GO:0042802	0.985	identical protein binding
GO:0097718	0.950	disordered domain specific binding
GO:1901363	0.464	heterocyclic compound binding
GO:0097159	0.464	organic cyclic compound binding
GO:0003676	0.364	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0080090	0.990	regulation of primary metabolic process
GO:0060255	0.990	regulation of macromolecule metabolic process
GO:0071840	0.988	cellular component organization or biogenesis
GO:0051171	0.988	regulation of nitrogen compound metabolic process
GO:0050794	0.987	regulation of cellular process
GO:0006308	0.987	DNA catabolic process
GO:0097194	0.983	execution phase of apoptosis
GO:0048519	0.982	negative regulation of biological process
GO:0048523	0.960	negative regulation of cellular process
GO:0016043	0.958	cellular component organization
GO:0031323	0.956	regulation of cellular metabolic process
GO:0009892	0.956	negative regulation of metabolic process
GO:0022411	0.951	cellular component disassembly
GO:0019219	0.950	regulation of nucleobase-containing compound metabolic process
GO:0010605	0.943	negative regulation of macromolecule metabolic process
GO:0009894	0.933	regulation of catabolic process
GO:0051052	0.917	regulation of DNA metabolic process
GO:0031329	0.892	regulation of cellular catabolic process
GO:0031324	0.857	negative regulation of cellular metabolic process
GO:0006996	0.834	organelle organization
GO:0045934	0.805	negative regulation of nucleobase-containing compound metabolic process
GO:0009895	0.800	negative regulation of catabolic process
GO:0051053	0.771	negative regulation of DNA metabolic process
GO:0031330	0.717	negative regulation of cellular catabolic process
GO:0051276	0.715	chromosome organization
GO:0030262	0.475	apoptotic nuclear changes
GO:0006309	0.461	apoptotic DNA fragmentation
GO:0030261	0.334	chromosome condensation
GO:0050896	0.324	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0005654	0.998	nucleoplasm
GO:0032991	0.986	protein-containing complex
GO:0005737	0.986	cytoplasm
GO:0005829	0.976	cytosol
GO:0005730	0.944	nucleolus
GO:0005694	0.788	chromosome
GO:0000785	0.571	chromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.-.-	1.000	Acting on ester bonds.

[back to server]