StarFunc result for job id O76083

User Input

>input (593 residues)
MGSGSSSYRPKAIYLDIDGRIQKVIFSKYCNSSDIMDLFCIATGLPRNTTISLLTTDDAM
VSIDPTMPANSERTPYKVRPVAIKQLSAGVEDKRTTSRGQSAERPLRDRRVVGLEQPRRE
GAFESGQVEPRPREPQGCYQEGQRIPPEREELIQSVLAQVAEQFSRAFKINELKAEVANH
LAVLEKRVELEGLKVVEIEKCKSDIKKMREELAARSSRTNCPCKYSFLDNHKKLTPRRDV
PTYPKYLLSPETIEALRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLF
CVHDNYRNNPFHNFRHCFCVAQMMYSMVWLCSLQEKFSQTDILILMTAAICHDLDHPGYN
NTYQINARTELAVRYNDISPLENHHCAVAFQILAEPECNIFSNIPPDGFKQIRQGMITLI
LATDMARHAEIMDSFKEKMENFDYSNEEHMTLLKMILIKCCDISNEVRPMEVAEPWVDCL
LEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIGFIKFVLIPMFETVTKLFPMVEEIML
QPLWESRDRYEELKRIDDAMKELQKKTDSLTSGATEKSRERSRDVKNSEGDCA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0S2Z4T6	0.583	0.583	1.179E-77	593	1.000	1.000	A0A0S2Z4T6.pdb.gz	A0A0S2Z4T6_HUMAN Phosphodiesterase (Fragment) OS=Homo sapiens OX=9606 GN=PDE9A PE=2 SV=1
2	AFDB:O70628	0.580	0.644	4.995E-68	534	0.811	0.901	O70628.pdb.gz	PDE9A_MOUSE High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A OS=Mus musculus OX=10090 GN=Pde9a PE=1 SV=1
3	PDB:4y86B	0.539	0.976	6.082E-45	326	0.546	0.994	4y86B.pdb.gz	Structural Asymmetry of Phosphodiesterase-9A and a Unique Pocket for Selective Binding of a Potent Enantiomeric Inhibitor.
4	AFDB:Q23917	0.532	0.400	2.694E-25	793	0.236	0.177	Q23917.pdb.gz	PDE2_DICDI 3',5'-cyclic-nucleotide phosphodiesterase regA OS=Dictyostelium discoideum OX=44689 GN=regA PE=1 SV=1
5	AFDB:B0G0Y8	0.510	0.646	1.580E-23	466	0.172	0.219	B0G0Y8.pdb.gz	PDE3_DICDI cGMP-specific 3',5'-cGMP phosphodiesterase 3 OS=Dictyostelium discoideum OX=44689 GN=pde3 PE=1 SV=1
6	AFDB:Q9W4S9	0.514	0.315	4.294E-22	983	0.226	0.136	Q9W4S9.pdb.gz	PDE4C_DROME cAMP-specific 3',5'-cyclic phosphodiesterase, isoforms N/G OS=Drosophila melanogaster OX=7227 GN=dnc PE=3 SV=2
7	AFDB:Q8VID6	0.505	0.322	4.919E-22	935	0.162	0.103	Q8VID6.pdb.gz	PDE11_RAT Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A OS=Rattus norvegicus OX=10116 GN=Pde11a PE=1 SV=1
8	AFDB:Q9W4T4	0.504	0.255	1.457E-21	1209	0.216	0.106	Q9W4T4.pdb.gz	PDE4A_DROME cAMP-specific 3',5'-cyclic phosphodiesterase, isoform I OS=Drosophila melanogaster OX=7227 GN=dnc PE=1 SV=2
9	AFDB:O89084	0.496	0.351	1.746E-21	844	0.211	0.148	O89084.pdb.gz	PDE4A_MOUSE cAMP-specific 3',5'-cyclic phosphodiesterase 4A OS=Mus musculus OX=10090 GN=Pde4a PE=1 SV=2
10	AFDB:Q2V4U0	0.494	0.438	1.911E-21	673	0.180	0.159	Q2V4U0.pdb.gz	Q2V4U0_CAEEL Phosphodiesterase OS=Caenorhabditis elegans OX=6239 GN=pde-4 PE=1 SV=1
11	AFDB:P27815	0.499	0.336	2.290E-21	886	0.219	0.147	P27815.pdb.gz	PDE4A_HUMAN cAMP-specific 3',5'-cyclic phosphodiesterase 4A OS=Homo sapiens OX=9606 GN=PDE4A PE=1 SV=3
12	PDB:7jsnA	0.493	0.362	6.287E-18	820	0.162	0.117	7jsnA.pdb.gz	Structure of the Visual Signaling Complex between Transducin and Phosphodiesterase 6.
13	PDB:6mzbB	0.494	0.366	4.203E-17	807	0.145	0.107	6mzbB.pdb.gz	Cryo-EM structure of phosphodiesterase 6 reveals insights into the allosteric regulation of type I phosphodiesterases.
14	PDB:3bjcA	0.444	0.829	1.492E-16	311	0.143	0.273	3bjcA.pdb.gz	An insight into the pharmacophores of phosphodiesterase-5 inhibitors from synthetic and crystal structural studies
15	PDB:1j0gA	0.106	0.529	2.750E-1	92	0.013	0.087	1j0gA.pdb.gz
16	PDB:6yvaC	0.101	0.334	2.877E-1	155	0.012	0.045	6yvaC.pdb.gz
17	PDB:3ai5A	0.097	0.182	3.150E-1	299	0.010	0.020	3ai5A.pdb.gz
18	PDB:3pgeA	0.102	0.299	3.295E-1	172	0.019	0.064	3pgeA.pdb.gz
19	PDB:7uzqK	0.091	0.117	3.295E-1	380	0.040	0.063	7uzqK.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
20	PDB:5xqmA	0.081	0.375	3.448E-1	90	0.019	0.122	5xqmA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z475	0.0	901	465	0.722	0.920	A0A0S2Z475_HUMAN Phosphodiesterase (Fragment) OS=Homo sapiens OX=9606 GN=PDE9A PE=2 SV=1
2	A0A0S2Z4A3	0.0	1005	533	0.847	0.942	A0A0S2Z4A3_HUMAN Phosphodiesterase (Fragment) OS=Homo sapiens OX=9606 GN=PDE9A PE=2 SV=1
3	A0A0S2Z4T6	0.0	1240	593	1.000	1.000	A0A0S2Z4T6_HUMAN Phosphodiesterase (Fragment) OS=Homo sapiens OX=9606 GN=PDE9A PE=2 SV=1
4	O70628	0.0	930	534	0.777	0.863	PDE9A_MOUSE High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A OS=Mus musculus OX=10090 GN=Pde9a PE=1 SV=1
5	O76083	0.0	1240	593	1.000	1.000	PDE9A_HUMAN High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A OS=Homo sapiens OX=9606 GN=PDE9A PE=1 SV=1
6	Q8QZV1	0.0	923	534	0.771	0.856	PDE9A_RAT High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A OS=Rattus norvegicus OX=10116 GN=Pde9a PE=1 SV=1
7	Q23917	1.55e-67	236	793	0.218	0.163	PDE2_DICDI 3',5'-cyclic-nucleotide phosphodiesterase regA OS=Dictyostelium discoideum OX=44689 GN=regA PE=1 SV=1
8	B0G0Y8	1.51e-55	196	466	0.160	0.204	PDE3_DICDI cGMP-specific 3',5'-cGMP phosphodiesterase 3 OS=Dictyostelium discoideum OX=44689 GN=pde3 PE=1 SV=1
9	Q22000	2.68e-52	192	674	0.172	0.151	PDE4_CAEEL Probable 3',5'-cyclic phosphodiesterase pde-4 OS=Caenorhabditis elegans OX=6239 GN=pde-4 PE=2 SV=2
10	Q2V4U0	4.84e-52	191	673	0.172	0.152	Q2V4U0_CAEEL Phosphodiesterase OS=Caenorhabditis elegans OX=6239 GN=pde-4 PE=1 SV=1
11	P12252	7.37e-49	185	1070	0.160	0.089	PDE4B_DROME cAMP-specific 3',5'-cyclic phosphodiesterase OS=Drosophila melanogaster OX=7227 GN=dnc PE=1 SV=4
12	Q9W4T4	1.56e-48	184	1209	0.160	0.079	PDE4A_DROME cAMP-specific 3',5'-cyclic phosphodiesterase, isoform I OS=Drosophila melanogaster OX=7227 GN=dnc PE=1 SV=2
13	Q8IRU4	1.57e-48	181	662	0.160	0.144	PDE4E_DROME cAMP-specific 3',5'-cyclic phosphodiesterase, isoform F OS=Drosophila melanogaster OX=7227 GN=dnc PE=3 SV=1
14	Q9W4S9	2.11e-48	184	983	0.160	0.097	PDE4C_DROME cAMP-specific 3',5'-cyclic phosphodiesterase, isoforms N/G OS=Drosophila melanogaster OX=7227 GN=dnc PE=3 SV=2
15	A0A1B0GW84	6.93e-48	180	699	0.165	0.140	A0A1B0GW84_HUMAN Phosphodiesterase OS=Homo sapiens OX=9606 GN=PDE4D PE=1 SV=1
16	A0A140VJR0	9.90e-48	181	809	0.165	0.121	A0A140VJR0_HUMAN Phosphodiesterase OS=Homo sapiens OX=9606 GN=PDE4D PE=2 SV=1
17	Q08499	9.90e-48	181	809	0.165	0.121	PDE4D_HUMAN cAMP-specific 3',5'-cyclic phosphodiesterase 4D OS=Homo sapiens OX=9606 GN=PDE4D PE=1 SV=2
18	A0A1U7QDZ1	1.29e-47	180	804	0.165	0.122	A0A1U7QDZ1_MESAU Phosphodiesterase OS=Mesocricetus auratus OX=10036 GN=Pde4d PE=3 SV=1
19	P14270	1.97e-47	180	803	0.165	0.122	PDE4D_RAT cAMP-specific 3',5'-cyclic phosphodiesterase 4D OS=Rattus norvegicus OX=10116 GN=Pde4d PE=1 SV=4
20	Q01063	2.01e-47	179	747	0.165	0.131	PDE4D_MOUSE cAMP-specific 3',5'-cyclic phosphodiesterase 4D OS=Mus musculus OX=10090 GN=Pde4d PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12729 4HB_MCP_1	5.1e+02	11.6	Four helix bundle sensory module for signal transduction
2	PF01966 HD	2.9e+02	13.1	HD domain
3	PF00233 PDEase_I	2.7e-85	297.4	3'5'-cyclic nucleotide phosphodiesterase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000291539

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000282249	0.821	Guanylate cyclase soluble subunit alpha-2
2	9606.ENSP00000264424	0.816	Guanylate cyclase soluble subunit beta-1
3	9606.ENSP00000362987	0.794	Phytanoyl-CoA hydroxylase-interacting protein-like
4	9606.ENSP00000296518	0.793	Guanylate cyclase 1, soluble, alpha 3
5	9606.ENSP00000356825	0.787	Adenylate cyclase type 10
6	9606.ENSP00000357669	0.771	Atrial natriuretic peptide receptor 1
7	9606.ENSP00000419361	0.760	Adenylate cyclase type 5
8	9606.ENSP00000408292	0.755	E3 ubiquitin-protein ligase TRIM32
9	9606.ENSP00000254854	0.751	Retinal guanylyl cyclase 1
10	9606.ENSP00000294016	0.749	Adenylate cyclase type 9
11	9606.ENSP00000297323	0.748	Adenylate cyclase type 1
12	9606.ENSP00000341083	0.743	Atrial natriuretic peptide receptor 2
13	9606.ENSP00000260600	0.734	Adenylate cyclase type 3
14	9606.ENSP00000286355	0.734	Adenylate cyclase type 8
15	9606.ENSP00000311405	0.734	Adenylate cyclase type 6
16	9606.ENSP00000312126	0.734	Adenylate cyclase type 4
17	9606.ENSP00000342952	0.734	Adenylate cyclase type 2
18	9606.ENSP00000378187	0.734	Adenylate cyclase type 7
19	9606.ENSP00000218006	0.731	Retinal guanylyl cyclase 2
20	9606.ENSP00000261170	0.729	Heat-stable enterotoxin receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0047555	0.998	3',5'-cyclic-GMP phosphodiesterase activity
GO:0005515	0.993	protein binding
GO:0042802	0.803	identical protein binding
GO:0004115	0.444	3',5'-cyclic-AMP phosphodiesterase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.995	cellular metabolic process
GO:0044238	0.991	primary metabolic process
GO:0065007	0.986	biological regulation
GO:1901360	0.985	organic cyclic compound metabolic process
GO:0046483	0.985	heterocycle metabolic process
GO:0034641	0.985	cellular nitrogen compound metabolic process
GO:0006796	0.985	phosphate-containing compound metabolic process
GO:0050896	0.984	response to stimulus
GO:0009117	0.981	nucleotide metabolic process
GO:1901564	0.979	organonitrogen compound metabolic process
GO:0023052	0.978	signaling
GO:0007154	0.978	cell communication
GO:0050794	0.976	regulation of cellular process
GO:0006163	0.974	purine nucleotide metabolic process
GO:0019693	0.972	ribose phosphate metabolic process
GO:0051716	0.966	cellular response to stimulus
GO:0034655	0.966	nucleobase-containing compound catabolic process
GO:0009187	0.965	cyclic nucleotide metabolic process
GO:0009166	0.964	nucleotide catabolic process
GO:0052652	0.959	cyclic purine nucleotide metabolic process
GO:0007165	0.958	signal transduction
GO:1901136	0.955	carbohydrate derivative catabolic process
GO:0009154	0.953	purine ribonucleotide catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005829	1.000	cytosol
GO:0005654	0.996	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:16957	0.998	3',5'-cyclic GMP + H2O = GMP + H(+)
EC:3.1.4.35	0.998	3',5'-cyclic-GMP phosphodiesterase.
RHEA:25277	0.444	3',5'-cyclic AMP + H2O = AMP + H(+)
EC:3.1.4.53	0.444	3',5'-cyclic-AMP phosphodiesterase.

[back to server]