StarFunc result for job id O76093

User Input

>input (207 residues)
MYSAPSACTCLCLHFLLLCFQVQVLVAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSR
TSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKP
DGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPK
GQPELQKPFKYTTVTKRSRRIRPTHPA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O76093	1.000	1.000	3.979E-39	207	1.000	1.000	O76093.pdb.gz	FGF18_HUMAN Fibroblast growth factor 18 OS=Homo sapiens OX=9606 GN=FGF18 PE=1 SV=1
2	AFDB:Q0IIQ7	0.816	0.812	2.180E-27	208	0.599	0.596	Q0IIQ7.pdb.gz	Q0IIQ7_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=si:zc207o21.1 PE=2 SV=1
3	AFDB:O57341	0.821	0.811	1.571E-26	210	0.541	0.533	O57341.pdb.gz	FGF8A_DANRE Fibroblast growth factor 8 OS=Danio rerio OX=7955 GN=fgf8a PE=2 SV=1
4	AFDB:O60258	0.754	0.724	3.462E-26	216	0.527	0.505	O60258.pdb.gz	FGF17_HUMAN Fibroblast growth factor 17 OS=Homo sapiens OX=9606 GN=FGF17 PE=1 SV=1
5	AFDB:Q8AXC5	0.727	0.714	5.438E-26	211	0.527	0.517	Q8AXC5.pdb.gz	Q8AXC5_XENLA Fibroblast growth factor OS=Xenopus laevis OX=8355 GN=fgf8.L PE=2 SV=1
6	AFDB:Q4R0X9	0.728	0.704	1.779E-25	214	0.527	0.509	Q4R0X9.pdb.gz	Q4R0X9_CHICK Fibroblast growth factor OS=Gallus gallus OX=9031 GN=FGF8 PE=3 SV=1
7	AFDB:P55075	0.733	0.652	2.956E-25	233	0.551	0.489	P55075.pdb.gz	FGF8_HUMAN Fibroblast growth factor 8 OS=Homo sapiens OX=9606 GN=FGF8 PE=1 SV=1
8	AFDB:P37237	0.732	0.567	3.704E-25	268	0.541	0.418	P37237.pdb.gz	FGF8_MOUSE Fibroblast growth factor 8 OS=Mus musculus OX=10090 GN=Fgf8 PE=1 SV=1
9	AFDB:Q6SJP8	0.716	0.690	1.700E-24	215	0.498	0.479	Q6SJP8.pdb.gz	FG17_DANRE Fibroblast growth factor 17 OS=Danio rerio OX=7955 GN=fgf17 PE=2 SV=1
10	AFDB:P48805	0.612	0.675	5.239E-14	187	0.251	0.278	P48805.pdb.gz	FGF4A_XENLA Fibroblast growth factor 4A OS=Xenopus laevis OX=8355 GN=fgf4-a PE=2 SV=1
11	PDB:4jq0A	0.567	0.820	1.140E-10	141	0.164	0.241	4jq0A.pdb.gz	Structural analyses of Ca(2+)/CaM interaction with NaV channel C-termini reveal mechanisms of calcium-dependent regulation.
12	PDB:1ry7A	0.576	0.782	4.416E-10	151	0.184	0.252	1ry7A.pdb.gz
13	PDB:3f1rA	0.560	0.732	4.416E-10	157	0.208	0.274	3f1rA.pdb.gz	Homodimerization controls the fibroblast growth factor 9 subfamily's receptor binding and heparan sulfate-dependent diffusion in the extracellular matrix
14	PDB:6b0tA	0.535	0.238	5.465E-6	487	0.092	0.039	6b0tA.pdb.gz	Structural Insights into the Induced-fit Inhibition of Fascin by a Small-Molecule Inhibitor.
15	PDB:4qd2B	0.509	0.707	7.247E-6	143	0.101	0.147	4qd2B.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
16	PDB:2d43A	0.482	0.222	4.936E-5	482	0.126	0.054	2d43A.pdb.gz	The family 42 carbohydrate-binding module of family 54 alpha-L-arabinofuranosidase specifically binds the arabinofuranose side chain of hemicellulose
17	PDB:4qd2C	0.545	0.401	7.327E-5	286	0.082	0.059	4qd2C.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
18	PDB:1t9fA	0.470	0.539	1.912E-4	178	0.092	0.107	1t9fA.pdb.gz
19	PDB:3malA	0.443	0.502	2.141E-4	181	0.097	0.110	3malA.pdb.gz
20	PDB:3wmuB	0.460	0.603	4.213E-4	153	0.077	0.105	3wmuB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O76093	7.62e-157	433	207	1.000	1.000	FGF18_HUMAN Fibroblast growth factor 18 OS=Homo sapiens OX=9606 GN=FGF18 PE=1 SV=1
2	O89101	1.16e-154	428	207	0.986	0.986	FGF18_MOUSE Fibroblast growth factor 18 OS=Mus musculus OX=10090 GN=Fgf18 PE=2 SV=1
3	O88182	1.51e-154	427	207	0.986	0.986	FGF18_RAT Fibroblast growth factor 18 OS=Rattus norvegicus OX=10116 GN=Fgf18 PE=2 SV=1
4	Q0IIQ7	1.00e-90	266	208	0.604	0.601	Q0IIQ7_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=si:zc207o21.1 PE=2 SV=1
5	O57341	2.90e-76	230	210	0.546	0.538	FGF8A_DANRE Fibroblast growth factor 8 OS=Danio rerio OX=7955 GN=fgf8a PE=2 SV=1
6	Q90722	4.37e-74	224	214	0.541	0.523	FGF8_CHICK Fibroblast growth factor 8 OS=Gallus gallus OX=9031 GN=FGF8 PE=2 SV=1
7	Q90696	4.94e-74	224	204	0.531	0.539	Q90696_CHICK Fibroblast growth factor (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
8	Q4R0X9	5.68e-74	224	214	0.541	0.523	Q4R0X9_CHICK Fibroblast growth factor OS=Gallus gallus OX=9031 GN=FGF8 PE=3 SV=1
9	Q8AXC5	1.97e-73	223	211	0.536	0.526	Q8AXC5_XENLA Fibroblast growth factor OS=Xenopus laevis OX=8355 GN=fgf8.L PE=2 SV=1
10	C4P6Q2	1.29e-69	211	175	0.478	0.566	C4P6Q2_CHICK Fibroblast growth factor (Fragment) OS=Gallus gallus OX=9031 GN=FGF8 PE=2 SV=1
11	Q6SJP8	2.63e-68	210	215	0.507	0.488	FG17_DANRE Fibroblast growth factor 17 OS=Danio rerio OX=7955 GN=fgf17 PE=2 SV=1
12	A0A8I5ZL19	4.16e-68	210	244	0.464	0.393	A0A8I5ZL19_RAT Fibroblast growth factor OS=Rattus norvegicus OX=10116 GN=Fgf8 PE=3 SV=1
13	Q76LI5	1.35e-67	207	204	0.454	0.461	Q76LI5_RAT Fibroblast growth factor OS=Rattus norvegicus OX=10116 GN=Fgf8 PE=2 SV=1
14	P63075	2.13e-67	207	216	0.459	0.440	FGF17_MOUSE Fibroblast growth factor 17 OS=Mus musculus OX=10090 GN=Fgf17 PE=2 SV=1
15	O60258	3.76e-67	207	216	0.459	0.440	FGF17_HUMAN Fibroblast growth factor 17 OS=Homo sapiens OX=9606 GN=FGF17 PE=1 SV=1
16	P55075	7.18e-67	207	233	0.454	0.403	FGF8_HUMAN Fibroblast growth factor 8 OS=Homo sapiens OX=9606 GN=FGF8 PE=1 SV=1
17	A0A8I6B5D5	2.78e-66	206	268	0.454	0.351	A0A8I6B5D5_RAT Fibroblast growth factor OS=Rattus norvegicus OX=10116 GN=Fgf8 PE=3 SV=1
18	P37237	3.20e-66	206	268	0.454	0.351	FGF8_MOUSE Fibroblast growth factor 8 OS=Mus musculus OX=10090 GN=Fgf8 PE=1 SV=1
19	A0A8J8XTJ6	5.37e-66	203	189	0.444	0.487	A0A8J8XTJ6_RAT Fibroblast growth factor OS=Rattus norvegicus OX=10116 GN=Fgf8 PE=3 SV=1
20	Q6PBT8	8.45e-18	78.6	147	0.227	0.320	FGF1_DANRE Putative fibroblast growth factor 1 OS=Danio rerio OX=7955 GN=fgf1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00167 FGF	3.6e-39	145.0	Fibroblast growth factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010371609.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010382646.1	0.955	Fibroblast growth factor receptor 3 isoform X1
2	61622.XP_010384710.1	0.925	Fibroblast growth factor receptor 4
3	61622.XP_010378799.1	0.924	Fibroblast growth factor receptor 2 isoform X1
4	61622.XP_010383576.1	0.846	Fibroblast growth factor receptor 1
5	61622.XP_010361178.1	0.839	Kinase insert domain receptor
6	61622.XP_010360720.1	0.834	Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
7	61622.XP_010371930.1	0.825	Platelet-derived growth factor receptor beta
8	61622.XP_010360648.1	0.811	Fms related tyrosine kinase 1
9	61622.XP_010378850.1	0.801	Epidermal growth factor receptor isoform X1
10	61622.XP_010373326.1	0.794	Fms related tyrosine kinase 4
11	61622.XP_010382757.1	0.794	TEK receptor tyrosine kinase
12	61622.XP_010357288.1	0.777	Platelet-derived growth factor receptor alpha
13	61622.XP_010357283.1	0.771	KIT proto-oncogene receptor tyrosine kinase
14	61622.XP_010377602.1	0.762	Erb-b2 receptor tyrosine kinase 2
15	61622.XP_010386218.1	0.753	Potent mitogen for mature parenchymal hepatocyte cells, seems to be a hepatotrophic factor, and acts as a growth factor for a broad spectrum of tissues and cell types. Activating ligand for the receptor tyrosine kinase MET by binding to it and promoting its dimerization.
16	61622.XP_010387372.1	0.750	EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6
17	61622.XP_010385672.1	0.730	Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. MAP kinase subfamily
18	61622.XP_010357336.1	0.728	Receptor tyrosine-protein kinase erbB-4
19	61622.XP_010376118.1	0.728	Receptor tyrosine-protein kinase erbB-3
20	61622.XP_010371929.1	0.726	Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005104	1.000	fibroblast growth factor receptor binding
GO:0008083	0.997	growth factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0048518	0.991	positive regulation of biological process
GO:0048856	0.988	anatomical structure development
GO:0050896	0.986	response to stimulus
GO:0032501	0.985	multicellular organismal process
GO:0009987	0.984	cellular process
GO:0048522	0.984	positive regulation of cellular process
GO:0042127	0.974	regulation of cell population proliferation
GO:0048583	0.967	regulation of response to stimulus
GO:0007275	0.966	multicellular organism development
GO:0010646	0.963	regulation of cell communication
GO:0070372	0.950	regulation of ERK1 and ERK2 cascade
GO:0008284	0.940	positive regulation of cell population proliferation
GO:0007166	0.939	cell surface receptor signaling pathway
GO:0031325	0.932	positive regulation of cellular metabolic process
GO:0048731	0.926	system development
GO:0043410	0.922	positive regulation of MAPK cascade
GO:0080090	0.920	regulation of primary metabolic process
GO:0051171	0.920	regulation of nitrogen compound metabolic process
GO:0050793	0.917	regulation of developmental process
GO:0048513	0.912	animal organ development
GO:0051173	0.903	positive regulation of nitrogen compound metabolic process
GO:0009653	0.889	anatomical structure morphogenesis
GO:2000026	0.877	regulation of multicellular organismal development
GO:0050678	0.872	regulation of epithelial cell proliferation
GO:0009888	0.866	tissue development
GO:0030335	0.865	positive regulation of cell migration
GO:0050679	0.861	positive regulation of epithelial cell proliferation
GO:0051174	0.832	regulation of phosphorus metabolic process
GO:0060255	0.828	regulation of macromolecule metabolic process
GO:0009719	0.812	response to endogenous stimulus
GO:0010604	0.812	positive regulation of macromolecule metabolic process
GO:0051338	0.808	regulation of transferase activity
GO:0051246	0.804	regulation of protein metabolic process
GO:0019220	0.800	regulation of phosphate metabolic process
GO:0048519	0.785	negative regulation of biological process
GO:0010632	0.757	regulation of epithelial cell migration
GO:0042325	0.747	regulation of phosphorylation
GO:0044093	0.743	positive regulation of molecular function
GO:0001934	0.738	positive regulation of protein phosphorylation
GO:0010634	0.735	positive regulation of epithelial cell migration
GO:0048523	0.726	negative regulation of cellular process
GO:0070848	0.725	response to growth factor
GO:0051093	0.712	negative regulation of developmental process
GO:0043085	0.696	positive regulation of catalytic activity
GO:0051094	0.692	positive regulation of developmental process
GO:0007167	0.691	enzyme-linked receptor protein signaling pathway
GO:0051240	0.685	positive regulation of multicellular organismal process
GO:0045595	0.684	regulation of cell differentiation
GO:0010594	0.630	regulation of endothelial cell migration
GO:0007169	0.622	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0010595	0.612	positive regulation of endothelial cell migration
GO:0009887	0.603	animal organ morphogenesis
GO:0030154	0.598	cell differentiation
GO:0071363	0.595	cellular response to growth factor stimulus
GO:0043549	0.578	regulation of kinase activity
GO:0090287	0.547	regulation of cellular response to growth factor stimulus
GO:0051347	0.543	positive regulation of transferase activity
GO:0010468	0.535	regulation of gene expression
GO:0035556	0.486	intracellular signal transduction
GO:0071774	0.405	response to fibroblast growth factor
GO:0042221	0.401	response to chemical
GO:0061448	0.382	connective tissue development
GO:0033674	0.377	positive regulation of kinase activity
GO:0001501	0.367	skeletal system development
GO:0008152	0.339	metabolic process
GO:0045859	0.334	regulation of protein kinase activity
GO:0009889	0.320	regulation of biosynthetic process
GO:0019219	0.309	regulation of nucleobase-containing compound metabolic process
GO:0071704	0.306	organic substance metabolic process
GO:0010556	0.306	regulation of macromolecule biosynthetic process
GO:0031326	0.306	regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0070013	0.993	intracellular organelle lumen
GO:0005576	0.985	extracellular region
GO:0005737	0.984	cytoplasm
GO:0005634	0.982	nucleus
GO:0031981	0.967	nuclear lumen
GO:0071944	0.955	cell periphery
GO:0005886	0.939	plasma membrane
GO:0005615	0.891	extracellular space
GO:0043232	0.537	intracellular non-membrane-bounded organelle
GO:0005654	0.383	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]