StarFunc result for job id O76095

User Input

>input (146 residues)
MLAGAGRPGLPQGRHLCWLLCAFTLKLCQAEAPVQEEKLSASTSNLPCWLVEEFVVAEEC
SPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALMEQRLFWKFEGAVVCVALIF
ACLVIIRQRQLDRKALEKVRKQIESI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O76095	1.000	1.000	1.561E-24	146	1.000	1.000	O76095.pdb.gz	JTB_HUMAN Protein JTB OS=Homo sapiens OX=9606 GN=JTB PE=1 SV=1
2	AFDB:O88824	0.847	0.847	4.102E-21	146	0.856	0.856	O88824.pdb.gz	JTB_MOUSE Protein JTB OS=Mus musculus OX=10090 GN=Jtb PE=1 SV=1
3	AFDB:O14944	0.335	0.308	1.711E-1	169	0.199	0.172	O14944.pdb.gz	EREG_HUMAN Proepiregulin OS=Homo sapiens OX=9606 GN=EREG PE=1 SV=1
4	AFDB:Q80YV8	0.272	0.328	2.688E-1	119	0.089	0.109	Q80YV8.pdb.gz	Q80YV8_RAT Stromal cell-derived factor 1 OS=Rattus norvegicus OX=10116 GN=Cxcl12 PE=1 SV=1
5	AFDB:Q8K4B1	0.159	0.176	3.480E-1	125	0.110	0.128	Q8K4B1.pdb.gz	Q8K4B1_RAT C-X-C motif chemokine OS=Rattus norvegicus OX=10116 GN=Cxcl9 PE=2 SV=1
6	AFDB:Q61521	0.289	0.262	3.712E-1	162	0.123	0.111	Q61521.pdb.gz	EREG_MOUSE Proepiregulin OS=Mus musculus OX=10090 GN=Ereg PE=1 SV=1
7	AFDB:Q07325	0.158	0.183	3.959E-1	125	0.144	0.168	Q07325.pdb.gz	CXCL9_HUMAN C-X-C motif chemokine 9 OS=Homo sapiens OX=9606 GN=CXCL9 PE=1 SV=1
8	AFDB:P02778	0.166	0.231	4.505E-1	98	0.096	0.143	P02778.pdb.gz	CXL10_HUMAN C-X-C motif chemokine 10 OS=Homo sapiens OX=9606 GN=CXCL10 PE=1 SV=2
9	AFDB:P97885	0.188	0.209	4.805E-1	130	0.137	0.154	P97885.pdb.gz	CXCL5_RAT C-X-C motif chemokine 5 OS=Rattus norvegicus OX=10116 GN=Cxcl5 PE=2 SV=1
10	AFDB:Q05928	0.343	0.305	5.126E-1	177	0.164	0.136	Q05928.pdb.gz	BTC_MOUSE Probetacellulin OS=Mus musculus OX=10090 GN=Btc PE=1 SV=1
11	PDB:6b1uA	0.111	0.049	6.550E-1	442	0.096	0.032	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
12	PDB:1qe6D	0.175	0.293	1.098	72	0.082	0.167	1qe6D.pdb.gz
13	PDB:6gxnv	0.172	0.090	1.171	348	0.096	0.040	6gxnv.pdb.gz	Visualization of translation termination intermediates trapped by the Apidaecin 137 peptide during RF3-mediated recycling of RF1.
14	PDB:6adgC	0.148	0.075	1.839	390	0.055	0.021	6adgC.pdb.gz	Crystal structures of pan-IDH inhibitor AG-881 in complex with mutant human IDH1 and IDH2
15	PDB:4v6wCo	0.135	0.183	1.962	104	0.062	0.087	4v6wCo.pdb.gz	Structures of the human and Drosophila 80S ribosome.
16	PDB:1o80A	0.169	0.289	2.232	74	0.062	0.122	1o80A.pdb.gz
17	PDB:5yfnA	0.141	0.071	2.232	418	0.055	0.019	5yfnA.pdb.gz	Human isocitrate dehydrogenase 1 bound with isocitrate
18	PDB:6j6qF	0.268	0.244	2.232	161	0.110	0.099	6j6qF.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
19	PDB:6hlqI	0.111	0.143	2.381	111	0.103	0.135	6hlqI.pdb.gz	The cryo-EM structure of a 12-subunit variant of RNA polymerase I reveals dissociation of the A49-A34.5 heterodimer and rearrangement of subunit A12.2.
20	PDB:2luuA	0.167	0.189	2.540	127	0.062	0.071	2luuA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O76095	3.24e-104	295	146	1.000	1.000	JTB_HUMAN Protein JTB OS=Homo sapiens OX=9606 GN=JTB PE=1 SV=1
2	O88824	2.84e-82	240	146	0.856	0.856	JTB_MOUSE Protein JTB OS=Mus musculus OX=10090 GN=Jtb PE=1 SV=1
3	Q804S5	0.92	31.6	1030	0.164	0.023	MIB1_DANRE E3 ubiquitin-protein ligase mib1 OS=Danio rerio OX=7955 GN=mib1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05439 JTB	4.3e-32	121.8	Jumping translocation breakpoint protein (JTB)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000271843

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000282572	0.719	Cyclin-O
2	9606.ENSP00000318352	0.709	Morf4 family associated protein 1
3	9606.ENSP00000357596	0.683	Cyclic AMP-responsive element-binding protein 3-like protein 4
4	9606.ENSP00000344299	0.611	Protein prenyltransferase alpha subunit repeat containing 1
5	9606.ENSP00000252037	0.592	Inactive peptidyl-prolyl cis-trans isomerase FKBP6
6	9606.ENSP00000292211	0.584	Ubiquitin-conjugating enzyme E2 Q1
7	9606.ENSP00000389445	0.576	Ubiquitin-associated protein 2-like
8	9606.ENSP00000234739	0.560	B-cell CLL/lymphoma 9 protein
9	9606.ENSP00000350708	0.532	UV excision repair protein RAD23 homolog B
10	9606.ENSP00000467024	0.532	UV excision repair protein RAD23 homolog A
11	9606.ENSP00000348933	0.513	Coiled-coil domain containing 25
12	9606.ENSP00000255416	0.507	Myosin-binding protein H

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019901	1.000	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0065007	0.965	biological regulation
GO:0019222	0.942	regulation of metabolic process
GO:0051171	0.916	regulation of nitrogen compound metabolic process
GO:0031323	0.916	regulation of cellular metabolic process
GO:0080090	0.915	regulation of primary metabolic process
GO:0060255	0.913	regulation of macromolecule metabolic process
GO:0048518	0.842	positive regulation of biological process
GO:0051246	0.820	regulation of protein metabolic process
GO:0051174	0.684	regulation of phosphorus metabolic process
GO:0000278	0.638	mitotic cell cycle
GO:0051301	0.634	cell division
GO:0048522	0.589	positive regulation of cellular process
GO:0050790	0.568	regulation of catalytic activity
GO:0051338	0.560	regulation of transferase activity
GO:0009893	0.538	positive regulation of metabolic process
GO:0031325	0.484	positive regulation of cellular metabolic process
GO:0000910	0.478	cytokinesis
GO:0019220	0.465	regulation of phosphate metabolic process
GO:0010562	0.417	positive regulation of phosphorus metabolic process
GO:0071840	0.389	cellular component organization or biogenesis
GO:0051247	0.380	positive regulation of protein metabolic process
GO:0016043	0.338	cellular component organization
GO:0042325	0.305	regulation of phosphorylation
GO:0033674	0.300	positive regulation of kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	1.000	intracellular organelle
GO:0043231	0.986	intracellular membrane-bounded organelle
GO:0043232	0.984	intracellular non-membrane-bounded organelle
GO:0071944	0.967	cell periphery
GO:0016020	0.965	membrane
GO:0005886	0.863	plasma membrane
GO:0015630	0.680	microtubule cytoskeleton
GO:0005739	0.678	mitochondrion
GO:0005815	0.665	microtubule organizing center
GO:0005813	0.646	centrosome
GO:0070013	0.585	intracellular organelle lumen
GO:0031981	0.570	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]