StarFunc result for job id O76096

User Input

>input (145 residues)
MRAAGTLLAFCCLVLSTTGGPSPDTCSQDLNSRVKPGFPKTIKTNDPGVLQAARYSVEKF
NNCTNDMFLFKESRITRALVQIVKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQ
TLSCYSEVWVVPWLQHFEVPVLRCH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O76096	1.000	1.000	1.288E-25	145	1.000	1.000	O76096.pdb.gz	CYTF_HUMAN Cystatin-F OS=Homo sapiens OX=9606 GN=CST7 PE=1 SV=1
2	PDB:2ch9A	0.832	0.957	5.904E-21	126	0.834	0.960	2ch9A.pdb.gz	Structural Basis of Reduction-Dependent Activation of Human Cystatin F.
3	AFDB:O89098	0.847	0.852	6.714E-21	144	0.697	0.701	O89098.pdb.gz	CYTF_MOUSE Cystatin-F OS=Mus musculus OX=10090 GN=Cst7 PE=2 SV=1
4	AFDB:Q9JM84	0.687	0.674	4.331E-11	148	0.255	0.250	Q9JM84.pdb.gz	CST10_MOUSE Cystatin 10 OS=Mus musculus OX=10090 GN=Cst10 PE=1 SV=1
5	AFDB:P01034	0.698	0.694	1.085E-10	146	0.290	0.288	P01034.pdb.gz	CYTC_HUMAN Cystatin-C OS=Homo sapiens OX=9606 GN=CST3 PE=1 SV=1
6	AFDB:P01036	0.685	0.703	1.276E-10	141	0.248	0.255	P01036.pdb.gz	CYTS_HUMAN Cystatin-S OS=Homo sapiens OX=9606 GN=CST4 PE=1 SV=3
7	AFDB:P01037	0.682	0.700	1.347E-10	141	0.262	0.270	P01037.pdb.gz	CYTN_HUMAN Cystatin-SN OS=Homo sapiens OX=9606 GN=CST1 PE=1 SV=3
8	AFDB:Q15828	0.710	0.692	1.501E-10	149	0.241	0.235	Q15828.pdb.gz	CYTM_HUMAN Cystatin-M OS=Homo sapiens OX=9606 GN=CST6 PE=1 SV=1
9	AFDB:P21460	0.697	0.721	2.312E-10	140	0.255	0.264	P21460.pdb.gz	CYTC_MOUSE Cystatin-C OS=Mus musculus OX=10090 GN=Cst3 PE=1 SV=2
10	AFDB:P09228	0.682	0.700	2.576E-10	141	0.248	0.255	P09228.pdb.gz	CYTT_HUMAN Cystatin-SA OS=Homo sapiens OX=9606 GN=CST2 PE=1 SV=1
11	AFDB:P01038	0.678	0.706	3.198E-10	139	0.255	0.266	P01038.pdb.gz	CYT_CHICK Cystatin OS=Gallus gallus OX=9031 PE=1 SV=2
12	PDB:4n6mA	0.713	0.873	9.233E-10	117	0.241	0.299	4n6mA.pdb.gz
13	PDB:1yvbI	0.668	0.852	3.200E-9	111	0.241	0.315	1yvbI.pdb.gz
14	PDB:6uioA	0.667	0.845	4.671E-9	112	0.193	0.250	6uioA.pdb.gz	Maturation of the functional mouse CRES amyloid from globular form.
15	PDB:1rn7A	0.652	0.822	9.123E-8	112	0.207	0.268	1rn7A.pdb.gz
16	PDB:6rpvA	0.503	0.587	3.337E-7	120	0.269	0.325	6rpvA.pdb.gz
17	PDB:3lh4A	0.629	0.777	1.466E-5	115	0.131	0.165	3lh4A.pdb.gz
18	PDB:6ht9B	0.607	0.295	6.101E-4	316	0.131	0.060	6ht9B.pdb.gz	Structure of mammalian plasma fetuin-B and its mechanism of selective metallopeptidase inhibition.
19	PDB:1wnhA	0.494	0.334	1.070E-2	220	0.124	0.082	1wnhA.pdb.gz
20	PDB:1stfI	0.427	0.597	4.359E-2	98	0.103	0.153	1stfI.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O76096	4.18e-108	305	145	1.000	1.000	CYTF_HUMAN Cystatin-F OS=Homo sapiens OX=9606 GN=CST7 PE=1 SV=1
2	O89098	1.21e-68	205	144	0.655	0.660	CYTF_MOUSE Cystatin-F OS=Mus musculus OX=10090 GN=Cst7 PE=2 SV=1
3	P01034	2.20e-18	78.2	146	0.255	0.253	CYTC_HUMAN Cystatin-C OS=Homo sapiens OX=9606 GN=CST3 PE=1 SV=1
4	P01038	6.88e-18	76.6	139	0.241	0.252	CYT_CHICK Cystatin OS=Gallus gallus OX=9031 PE=1 SV=2
5	P21460	5.36e-17	74.3	140	0.241	0.250	CYTC_MOUSE Cystatin-C OS=Mus musculus OX=10090 GN=Cst3 PE=1 SV=2
6	P14841	1.13e-15	70.9	140	0.228	0.236	CYTC_RAT Cystatin-C OS=Rattus norvegicus OX=10116 GN=Cst3 PE=1 SV=2
7	Q9JM84	4.63e-15	69.7	148	0.297	0.291	CST10_MOUSE Cystatin 10 OS=Mus musculus OX=10090 GN=Cst10 PE=1 SV=1
8	P01037	7.44e-15	68.9	141	0.255	0.262	CYTN_HUMAN Cystatin-SN OS=Homo sapiens OX=9606 GN=CST1 PE=1 SV=3
9	Q98967	1.44e-14	67.8	130	0.228	0.254	CYT_ONCKE Cystatin OS=Oncorhynchus keta OX=8018 PE=1 SV=2
10	Q91195	2.09e-14	67.4	130	0.228	0.254	CYT_ONCMY Cystatin OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
11	A0A060VN46	2.68e-14	67.0	132	0.228	0.250	A0A060VN46_ONCMY Uncharacterized protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00077770001 PE=4 SV=1
12	P01036	3.93e-14	67.0	141	0.241	0.248	CYTS_HUMAN Cystatin-S OS=Homo sapiens OX=9606 GN=CST4 PE=1 SV=3
13	P01042	1.70e-12	65.5	644	0.255	0.057	KNG1_HUMAN Kininogen-1 OS=Homo sapiens OX=9606 GN=KNG1 PE=1 SV=2
14	Q15828	1.42e-11	60.5	149	0.290	0.282	CYTM_HUMAN Cystatin-M OS=Homo sapiens OX=9606 GN=CST6 PE=1 SV=1
15	P08934	1.52e-11	62.8	639	0.241	0.055	KNG1_RAT Kininogen-1 OS=Rattus norvegicus OX=10116 GN=Kng1 PE=2 SV=1
16	P28325	4.17e-11	58.9	142	0.276	0.282	CYTD_HUMAN Cystatin-D OS=Homo sapiens OX=9606 GN=CST5 PE=1 SV=1
17	P09228	7.69e-11	58.2	141	0.241	0.248	CYTT_HUMAN Cystatin-SA OS=Homo sapiens OX=9606 GN=CST2 PE=1 SV=1
18	Q8K397	2.28e-10	57.4	146	0.290	0.288	Q8K397_MOUSE Cst6 protein (Fragment) OS=Mus musculus OX=10090 GN=Cst6 PE=2 SV=1
19	Q9D1B1	2.35e-10	57.4	149	0.290	0.282	Q9D1B1_MOUSE Cystatin E/M OS=Mus musculus OX=10090 GN=Cst6 PE=1 SV=1
20	O08677	3.17e-10	59.3	661	0.221	0.048	KNG1_MOUSE Kininogen-1 OS=Mus musculus OX=10090 GN=Kng1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00666 Cathelicidins	95	14.7	Cathelicidin
2	PF00031 Cystatin	9.8e-14	62.7	Cystatin domain
3	PF07671 DUF1601	3.7e+02	12.4	Protein of unknown function (DUF1601)
4	PF07448 Spp-24	6	18.4	Secreted phosphoprotein 24 (Spp-24) cystatin-like domain
5	PF16845 SQAPI	10	17.9	Aspartic acid proteinase inhibitor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000420384

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000345344	0.858	Cathepsin L1
2	9606.ENSP00000366178	0.799	Cystatin-9-like
3	9606.ENSP00000221978	0.781	Protein NKG7
4	9606.ENSP00000248598	0.771	Fibroleukin
5	9606.ENSP00000376911	0.754	Legumain
6	9606.ENSP00000366208	0.747	Cystatin-11
7	9606.ENSP00000227266	0.722	Dipeptidyl peptidase 1
8	9606.ENSP00000274306	0.708	Granzyme A
9	9606.ENSP00000254898	0.702	Matrilin-2
10	9606.ENSP00000338290	0.684	GDNF-inducible zinc finger protein 1
11	9606.ENSP00000168148	0.674	Secreted phosphoprotein 24
12	9606.ENSP00000254998	0.662	NTF2-related export protein 1
13	9606.ENSP00000316924	0.662	Acetyl-coenzyme A synthetase 2-like, mitochondrial
14	9606.ENSP00000265029	0.658	Fetuin-B
15	9606.ENSP00000423673	0.656	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13
16	9606.ENSP00000317159	0.654	Cytochrome c1, heme protein, mitochondrial
17	9606.ENSP00000366170	0.638	Cystatin-9
18	9606.ENSP00000216338	0.634	Granzyme H
19	9606.ENSP00000355991	0.634	TRAF3-interacting JNK-activating modulator
20	9606.ENSP00000046794	0.628	Lymphocyte cytosolic protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004869	1.000	cysteine-type endopeptidase inhibitor activity
GO:0042802	0.920	identical protein binding
GO:0042803	0.860	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0050896	0.987	response to stimulus
GO:0051336	0.985	regulation of hydrolase activity
GO:0044092	0.982	negative regulation of molecular function
GO:0052547	0.981	regulation of peptidase activity
GO:0045861	0.978	negative regulation of proteolysis
GO:0002376	0.972	immune system process
GO:0010466	0.925	negative regulation of peptidase activity
GO:0050794	0.877	regulation of cellular process
GO:0006955	0.868	immune response
GO:0048518	0.631	positive regulation of biological process
GO:0009987	0.597	cellular process
GO:0048583	0.403	regulation of response to stimulus
GO:0051239	0.319	regulation of multicellular organismal process
GO:0002682	0.312	regulation of immune system process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0005615	1.000	extracellular space
GO:0031410	0.999	cytoplasmic vesicle
GO:0005764	0.986	lysosome
GO:0005768	0.950	endosome
GO:0005783	0.930	endoplasmic reticulum
GO:0005770	0.930	late endosome
GO:0005794	0.927	Golgi apparatus
GO:0071944	0.899	cell periphery
GO:0005886	0.880	plasma membrane
GO:0005771	0.546	multivesicular body
GO:0043233	0.378	organelle lumen
GO:0070013	0.370	intracellular organelle lumen
GO:0043230	0.310	extracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]