StarFunc result for job id O94759

User Input

>input (1503 residues)
MEPSALRKAGSEQEEGFEGLPRRVTDLGMVSNLRRSNSSLFKSWRLQCPFGNNDKQESLS
SWIPENIKKKECVYFVESSKLSDAGKVVCQCGYTHEQHLEEATKPHTFQGTQWDPKKHVQ
EMPTDAFGDIVFTGLSQKVKKYVRVSQDTPSSVIYHLMTQHWGLDVPNLLISVTGGAKNF
NMKPRLKSIFRRGLVKVAQTTGAWIITGGSHTGVMKQVGEAVRDFSLSSSYKEGELITIG
VATWGTVHRREGLIHPTGSFPAEYILDEDGQGNLTCLDSNHSHFILVDDGTHGQYGVEIP
LRTRLEKFISEQTKERGGVAIKIPIVCVVLEGGPGTLHTIDNATTNGTPCVVVEGSGRVA
DVIAQVANLPVSDITISLIQQKLSVFFQEMFETFTESRIVEWTKKIQDIVRRRQLLTVFR
EGKDGQQDVDVAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWK
PSDLHPTMTAALISNKPEFVKLFLENGVQLKEFVTWDTLLYLYENLDPSCLFHSKLQKVL
VEDPERPACAPAAPRLQMHHVAQVLRELLGDFTQPLYPRPRHNDRLRLLLPVPHVKLNVQ
GVSLRSLYKRSSGHVTFTMDPIRDLLIWAIVQNRRELAGIIWAQSQDCIAAALACSKILK
ELSKEEEDTDSSEEMLALAEEYEHRAIGVFTECYRKDEERAQKLLTRVSEAWGKTTCLQL
ALEAKDMKFVSHGGIQAFLTKVWWGQLSVDNGLWRVTLCMLAFPLLLTGLISFREKRLQD
VGTPAARARAFFTAPVVVFHLNILSYFAFLCLFAYVLMVDFQPVPSWCECAIYLWLFSLV
CEEMRQLFYDPDECGLMKKAALYFSDFWNKLDVGAILLFVAGLTCRLIPATLYPGRVILS
LDFILFCLRLMHIFTISKTLGPKIIIVKRMMKDVFFFLFLLAVWVVSFGVAKQAILIHNE
RRVDWLFRGAVYHSYLTIFGQIPGYIDGVNFNPEHCSPNGTDPYKPKCPESDATQQRPAF
PEWLTVLLLCLYLLFTNILLLNLLIAMFNYTFQQVQEHTDQIWKFQRHDLIEEYHGRPAA
PPPFILLSHLQLFIKRVVLKTPAKRHKQLKNKLEKNEEAALLSWEIYLKENYLQNRQFQQ
KQRPEQKIEDISNKVDAMVDLLDLDPLKRSGSMEQRLASLEEQVAQTAQALHWIVRTLRA
SGFSSEADVPTLASQKAAEEPDAEPGGRKKTEEPGDSYHVNARHLLYPNCPVTRFPVPNE
KVPWETEFLIYDPPFYTAERKDAAAMDPMGDTLEPLSTIQYNVVDGLRDRRSFHGPYTVQ
AGLPLNPMGRTGLRGRGSLSCFGPNHTLYPMVTRWRRNEDGAICRKSIKKMLEVLVVKLP
LSEHWALPGGSREPGEMLPRKLKRILRQEHWPSFENLLKCGMEVYKGYMDDPRNTDNAWI
ETVAVSVHFQDQNDVELNRLNSNLHACDSGASIRWQVVDRRIPLYANHKTLLQKAAAEFG
AHY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6mj2A	0.719	0.796	0.000	1337	0.885	0.995	6mj2A.pdb.gz	Structures and gating mechanism of human TRPM2.
2	PDB:6puuA	0.808	0.923	0.000	1309	0.868	0.997	6puuA.pdb.gz	Ligand recognition and gating mechanism through three ligand-binding sites of human TRPM2 channel.
3	AFDB:A0A0R4IMY7	0.837	0.855	0.000	1470	0.501	0.512	A0A0R4IMY7.pdb.gz	TRPM2_DANRE Transient receptor potential cation channel subfamily M member 2 OS=Danio rerio OX=7955 GN=trpm2 PE=1 SV=2
4	AFDB:A7T1N0	0.767	0.745	0.000	1551	0.348	0.337	A7T1N0.pdb.gz	TMP2L_NEMVE Transient receptor potential cation channel subfamily M member-like 2 OS=Nematostella vectensis OX=45351 GN=TRPM2 PE=1 SV=1
5	AFDB:E9PTA2	0.906	0.904	0.000	1507	0.849	0.847	E9PTA2.pdb.gz	TRPM2_RAT Transient receptor potential cation channel subfamily M member 2 OS=Rattus norvegicus OX=10116 GN=Trpm2 PE=1 SV=3
6	AFDB:O94759	1.000	1.000	0.000	1503	1.000	1.000	O94759.pdb.gz	TRPM2_HUMAN Transient receptor potential cation channel subfamily M member 2 OS=Homo sapiens OX=9606 GN=TRPM2 PE=1 SV=2
7	PDB:6drjA	0.628	0.725	3.733E-99	1266	0.466	0.553	6drjA.pdb.gz	Architecture of the TRPM2 channel and its activation mechanism by ADP-ribose and calcium.
8	PDB:6pkxB	0.619	0.740	9.511E-91	1218	0.454	0.560	6pkxB.pdb.gz	Visualizing structural transitions of ligand-dependent gating of the TRPM2 channel.
9	AFDB:U3JD03	0.623	0.826	1.389E-88	1115	0.313	0.422	U3JD03.pdb.gz	U3JD03_FICAL Transient receptor potential cation channel subfamily M member 8 OS=Ficedula albicollis OX=59894 PE=1 SV=2
10	AFDB:I3IS25	0.673	0.794	1.665E-88	1260	0.311	0.371	I3IS25.pdb.gz
11	AFDB:Q7Z2W7	0.616	0.821	2.089E-88	1104	0.306	0.417	Q7Z2W7.pdb.gz	TRPM8_HUMAN Transient receptor potential cation channel subfamily M member 8 OS=Homo sapiens OX=9606 GN=TRPM8 PE=1 SV=2
12	AFDB:Q7TN37	0.676	0.828	6.609E-86	1213	0.288	0.357	Q7TN37.pdb.gz	TRPM4_MOUSE Transient receptor potential cation channel subfamily M member 4 OS=Mus musculus OX=10090 GN=Trpm4 PE=1 SV=1
13	AFDB:Q8TD43	0.652	0.797	2.053E-85	1214	0.291	0.360	Q8TD43.pdb.gz	TRPM4_HUMAN Transient receptor potential cation channel subfamily M member 4 OS=Homo sapiens OX=9606 GN=TRPM4 PE=1 SV=1
14	AFDB:Q9NZQ8	0.594	0.752	6.858E-82	1165	0.301	0.388	Q9NZQ8.pdb.gz	TRPM5_HUMAN Transient receptor potential cation channel subfamily M member 5 OS=Homo sapiens OX=9606 GN=TRPM5 PE=1 SV=1
15	PDB:6pkvA	0.646	0.878	2.583E-80	1087	0.405	0.559	6pkvA.pdb.gz
16	PDB:6co7A	0.605	0.848	1.311E-70	1061	0.250	0.353	6co7A.pdb.gz	Structure of a TRPM2 channel in complex with Ca2+explains unique gating regulation.
17	PDB:6bcqB	0.561	0.826	3.859E-66	983	0.263	0.403	6bcqB.pdb.gz	Structures of the calcium-activated, non-selective cation channel TRPM4.
18	PDB:6pkwB	0.577	0.857	4.344E-63	986	0.365	0.556	6pkwB.pdb.gz
19	PDB:8e4nA	0.491	0.784	1.244E-61	901	0.273	0.455	8e4nA.pdb.gz	Activation mechanism of the mouse cold-sensing TRPM8 channel by cooling agonist and PIP 2.
20	PDB:7wrbA	0.516	0.803	1.957E-61	930	0.281	0.454	7wrbA.pdb.gz	Structures of a mammalian TRPM8 in closed state.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IMY7	0.0	1366	1470	0.504	0.515	TRPM2_DANRE Transient receptor potential cation channel subfamily M member 2 OS=Danio rerio OX=7955 GN=trpm2 PE=1 SV=2
2	A0A455XI77	0.0	725	1156	0.300	0.390	A0A455XI77_RAT Transient receptor potential cation channel subfamily M member 5 OS=Rattus norvegicus OX=10116 GN=Trpm5 PE=2 SV=1
3	A0A8I6AG64	0.0	726	1164	0.300	0.387	A0A8I6AG64_RAT Transient receptor potential cation channel, subfamily M, member 5 OS=Rattus norvegicus OX=10116 GN=Trpm5 PE=4 SV=1
4	E9PTA2	0.0	2558	1507	0.850	0.847	TRPM2_RAT Transient receptor potential cation channel subfamily M member 2 OS=Rattus norvegicus OX=10116 GN=Trpm2 PE=1 SV=3
5	F1LMD7	0.0	726	1187	0.300	0.380	F1LMD7_RAT Transient receptor potential cation channel, subfamily M, member 5 OS=Rattus norvegicus OX=10116 GN=Trpm5 PE=4 SV=3
6	O94759	0.0	3127	1503	1.000	1.000	TRPM2_HUMAN Transient receptor potential cation channel subfamily M member 2 OS=Homo sapiens OX=9606 GN=TRPM2 PE=1 SV=2
7	Q7TN37	0.0	686	1213	0.287	0.356	TRPM4_MOUSE Transient receptor potential cation channel subfamily M member 4 OS=Mus musculus OX=10090 GN=Trpm4 PE=1 SV=1
8	Q7Z2W7	0.0	848	1104	0.306	0.417	TRPM8_HUMAN Transient receptor potential cation channel subfamily M member 8 OS=Homo sapiens OX=9606 GN=TRPM8 PE=1 SV=2
9	Q8R455	0.0	845	1104	0.311	0.423	TRPM8_RAT Transient receptor potential cation channel subfamily M member 8 OS=Rattus norvegicus OX=10116 GN=Trpm8 PE=1 SV=4
10	Q8R4D5	0.0	847	1104	0.313	0.427	TRPM8_MOUSE Transient receptor potential cation channel subfamily M member 8 OS=Mus musculus OX=10090 GN=Trpm8 PE=1 SV=3
11	Q8TD43	0.0	663	1214	0.293	0.363	TRPM4_HUMAN Transient receptor potential cation channel subfamily M member 4 OS=Homo sapiens OX=9606 GN=TRPM4 PE=1 SV=1
12	Q91YD4	0.0	2544	1506	0.854	0.852	TRPM2_MOUSE Transient receptor potential cation channel subfamily M member 2 OS=Mus musculus OX=10090 GN=Trpm2 PE=1 SV=2
13	Q9ESQ5	0.0	684	1208	0.290	0.361	TRPM4_RAT Transient receptor potential cation channel subfamily M member 4 OS=Rattus norvegicus OX=10116 GN=Trpm4 PE=1 SV=2
14	Q9JJH7	0.0	724	1158	0.301	0.391	TRPM5_MOUSE Transient receptor potential cation channel subfamily M member 5 OS=Mus musculus OX=10090 GN=Trpm5 PE=1 SV=1
15	Q9NZQ8	0.0	733	1165	0.304	0.392	TRPM5_HUMAN Transient receptor potential cation channel subfamily M member 5 OS=Homo sapiens OX=9606 GN=TRPM5 PE=1 SV=1
16	S5TRY1	0.0	765	1260	0.318	0.379	S5TRY1_DANRE Transient receptor potential cation channel, subfamily M, member 4a OS=Danio rerio OX=7955 GN=TRPM4a PE=2 SV=1
17	U3JD03	0.0	875	1115	0.311	0.420	U3JD03_FICAL Transient receptor potential cation channel subfamily M member 8 OS=Ficedula albicollis OX=59894 PE=1 SV=2
18	Q9HCF6	2.15e-174	570	1732	0.271	0.236	TRPM3_HUMAN Transient receptor potential cation channel subfamily M member 3 OS=Homo sapiens OX=9606 GN=TRPM3 PE=1 SV=4
19	Q96QT4	1.15e-155	520	1865	0.259	0.209	TRPM7_HUMAN Transient receptor potential cation channel subfamily M member 7 OS=Homo sapiens OX=9606 GN=TRPM7 PE=1 SV=1
20	Q923J1	1.12e-154	518	1863	0.257	0.207	TRPM7_MOUSE Transient receptor potential cation channel subfamily M member 7 OS=Mus musculus OX=10090 GN=Trpm7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00520 Ion_trans	2.4e-16	71.3	Ion transport protein
2	PF18306 LDcluster4	25	15.8	SLOG cluster4 family
3	PF18139 LSDAT_euk	9.4e-76	266.3	SLOG in TRPM
4	PF18171 LSDAT_prok	2.4e-22	90.7	SLOG in TRPM, prokaryote
5	PF08016 PKD_channel	5e+02	11.5	Polycystin cation channel

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000381023

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000342222	0.935	Transient receptor potential cation channel subfamily V member 2
2	9606.ENSP00000320239	0.841	Transient receptor potential cation channel subfamily M member 7
3	9606.ENSP00000388550	0.730	RING finger protein 24
4	9606.ENSP00000459962	0.692	Transient receptor potential cation channel, subfamily V, member 1
5	9606.ENSP00000461007	0.692	Transient receptor potential cation channel subfamily V member 1
6	9606.ENSP00000363435	0.679	Inositol 1,4,5-trisphosphate receptor type 3
7	9606.ENSP00000265310	0.664	Transient receptor potential cation channel subfamily V member 5
8	9606.ENSP00000340913	0.645	Short transient receptor potential channel 6
9	9606.ENSP00000262209	0.639	Transient receptor potential cation channel subfamily A member 1
10	9606.ENSP00000352358	0.636	Transient receptor potential cation channel subfamily V member 6
11	9606.ENSP00000417569	0.611	Stromal interaction molecule 2
12	9606.ENSP00000262304	0.610	Polycystin-1
13	9606.ENSP00000256999	0.608	Glutamate carboxypeptidase 2
14	9606.ENSP00000478059	0.607	Stromal interaction molecule 1
15	9606.ENSP00000321987	0.604	Thrombospondin-type laminin G domain and EAR repeat-containing protein
16	9606.ENSP00000322249	0.588	Protein orai-3
17	9606.ENSP00000348752	0.588	Protein orai-2
18	9606.ENSP00000264079	0.586	Mucolipin-1
19	9606.ENSP00000359621	0.583	Mucolipin-3
20	9606.ENSP00000306253	0.562	Inositol 1,4,5-trisphosphate receptor type 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	0.998	binding
GO:0099604	0.998	ligand-gated calcium channel activity
GO:0043167	0.978	ion binding
GO:0005217	0.955	intracellular ligand-gated monoatomic ion channel activity
GO:0005515	0.954	protein binding
GO:0043168	0.954	anion binding
GO:0005509	0.949	calcium ion binding
GO:0097367	0.939	carbohydrate derivative binding
GO:1901363	0.803	heterocyclic compound binding
GO:0097159	0.796	organic cyclic compound binding
GO:0015278	0.574	calcium-release channel activity
GO:0072571	0.321	mono-ADP-D-ribose binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050789	0.989	regulation of biological process
GO:0070588	0.986	calcium ion transmembrane transport
GO:0050794	0.984	regulation of cellular process
GO:0050896	0.701	response to stimulus
GO:0032879	0.637	regulation of localization
GO:0051716	0.533	cellular response to stimulus
GO:0032501	0.469	multicellular organismal process
GO:0071840	0.465	cellular component organization or biogenesis
GO:0097553	0.441	calcium ion transmembrane import into cytosol
GO:0006950	0.430	response to stress
GO:0016043	0.419	cellular component organization
GO:0042221	0.416	response to chemical
GO:0048519	0.413	negative regulation of biological process
GO:0048518	0.400	positive regulation of biological process
GO:0048523	0.307	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.750	intracellular anatomical structure
GO:0043226	0.746	organelle
GO:0043231	0.711	intracellular membrane-bounded organelle
GO:0005737	0.700	cytoplasm
GO:0012505	0.447	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	0.998	Ca(2+)(in) = Ca(2+)(out)

[back to server]