StarFunc result for job id O94760

User Input

>input (285 residues)
MAGLGHPAAFGRATHAVVRALPESLGQHALRSAKGEEVDVARAERQHQLYVGVLGSKLGL
QVVELPADESLPDCVFVEDVAVVCEETALITRPGAPSRRKEVDMMKEALEKLQLNIVEMK
DENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADTFKDYAVSTVPVADGLHLKSFCSM
AGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDIAANCIYLNIPNKGHVLLHRTPE
EYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLINKKVDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O08557	0.997	0.997	2.274E-58	285	0.933	0.933	O08557.pdb.gz	DDAH1_RAT N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 OS=Rattus norvegicus OX=10116 GN=Ddah1 PE=1 SV=3
2	PDB:6szqD	0.979	0.975	2.332E-57	286	0.993	0.990	6szqD.pdb.gz
3	AFDB:O95865	0.946	0.946	1.952E-37	285	0.498	0.498	O95865.pdb.gz	DDAH2_HUMAN N(G),N(G)-dimethylarginine dimethylaminohydrolase 2 OS=Homo sapiens OX=9606 GN=DDAH2 PE=1 SV=1
4	AFDB:P71889	0.740	0.702	3.762E-15	302	0.193	0.182	P71889.pdb.gz	DDAH_MYCTU N(G),N(G)-dimethylarginine dimethylaminohydrolase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2323c PE=1 SV=1
5	AFDB:Q389F5	0.741	0.687	5.186E-14	310	0.200	0.184	Q389F5.pdb.gz	Q389F5_TRYB2 Mitochondrial RNA binding protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.1910 PE=4 SV=1
6	PDB:1jdxA	0.732	0.592	3.983E-12	360	0.151	0.119	1jdxA.pdb.gz	The ligand-induced structural changes of human L-Arginine:Glycine amidinotransferase. A mutational and crystallographic study.
7	AFDB:P9WQ05	0.719	0.529	7.381E-11	402	0.232	0.164	P9WQ05.pdb.gz	ARCA_MYCTU Arginine deiminase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=arcA PE=1 SV=1
8	AFDB:F4ZCI3	0.766	0.590	7.846E-11	379	0.179	0.135	F4ZCI3.pdb.gz	NNHA_MYCS0 2-nitroimidazole nitrohydrolase OS=Mycobacterium sp. (strain JS330) OX=1004011 GN=nnhA PE=1 SV=1
9	AFDB:Q5E7U3	0.733	0.530	1.278E-10	406	0.214	0.150	Q5E7U3.pdb.gz	ARCA_ALIF1 Arginine deiminase OS=Aliivibrio fischeri (strain ATCC 700601 / ES114) OX=312309 GN=arcA PE=3 SV=1
10	PDB:3h7cX	0.664	0.528	1.750E-10	369	0.144	0.111	3h7cX.pdb.gz	Structural Insights into the Catalytic Mechanism of Arabidopsis thaliana Agmatine Deiminase
11	AFDB:A0A140VK19	0.736	0.511	3.833E-10	423	0.154	0.104	A0A140VK19.pdb.gz	A0A140VK19_HUMAN Glycine amidinotransferase OS=Homo sapiens OX=9606 PE=2 SV=1
12	AFDB:Q9I6J9	0.638	0.514	3.833E-10	368	0.172	0.133	Q9I6J9.pdb.gz	AGUA_PSEAE Agmatine deiminase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=aguA PE=1 SV=1
13	AFDB:P13981	0.715	0.507	1.222E-9	418	0.207	0.141	P13981.pdb.gz	ARCA_PSEAE Arginine deiminase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=arcA PE=1 SV=2
14	PDB:1rxxC	0.686	0.495	1.574E-9	412	0.218	0.150	1rxxC.pdb.gz
15	PDB:1ynhB	0.650	0.448	2.205E-7	440	0.130	0.084	1ynhB.pdb.gz	Crystal structure of N-succinylarginine dihydrolase AstB, bound to substrate and product, an enzyme from the arginine catabolic pathway of Escherichia coli.
16	PDB:5hp5A	0.585	0.283	3.434E-6	669	0.126	0.054	5hp5A.pdb.gz	Monomeric Form of Peptidylarginine Deiminase Type I Revealed by X-ray Crystallography and Small-Angle X-ray Scattering
17	PDB:5n0zA	0.583	0.284	8.576E-6	638	0.119	0.053	5n0zA.pdb.gz	Development of a Selective Inhibitor of Protein Arginine Deiminase 2.
18	PDB:7d56C	0.612	0.299	1.926E-4	640	0.102	0.045	7d56C.pdb.gz	Structures of human peptidylarginine deiminase type III provide insights into substrate recognition and inhibitor design.
19	PDB:4n2iA	0.571	0.276	5.435E-4	662	0.144	0.062	4n2iA.pdb.gz	Protein arginine deiminase 2 binds calcium in an ordered fashion: implications for inhibitor design.
20	PDB:4n20A	0.530	0.266	1.130E-3	639	0.130	0.058	4n20A.pdb.gz	Protein arginine deiminase 2 binds calcium in an ordered fashion: implications for inhibitor design.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O08557	0.0	551	285	0.933	0.933	DDAH1_RAT N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 OS=Rattus norvegicus OX=10116 GN=Ddah1 PE=1 SV=3
2	O94760	0.0	585	285	1.000	1.000	DDAH1_HUMAN N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 OS=Homo sapiens OX=9606 GN=DDAH1 PE=1 SV=3
3	P56965	0.0	552	285	0.940	0.940	DDAH1_BOVIN N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 OS=Bos taurus OX=9913 GN=DDAH1 PE=1 SV=3
4	Q9CWS0	0.0	554	285	0.937	0.937	DDAH1_MOUSE N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 OS=Mus musculus OX=10090 GN=Ddah1 PE=1 SV=3
5	Q3SX44	4.85e-95	283	285	0.519	0.519	DDAH2_BOVIN N(G),N(G)-dimethylarginine dimethylaminohydrolase 2 OS=Bos taurus OX=9913 GN=DDAH2 PE=2 SV=1
6	Q6MG60	5.90e-91	273	285	0.516	0.516	DDAH2_RAT N(G),N(G)-dimethylarginine dimethylaminohydrolase 2 OS=Rattus norvegicus OX=10116 GN=Ddah2 PE=1 SV=1
7	O95865	1.15e-88	267	285	0.509	0.509	DDAH2_HUMAN N(G),N(G)-dimethylarginine dimethylaminohydrolase 2 OS=Homo sapiens OX=9606 GN=DDAH2 PE=1 SV=1
8	V9HW53	1.15e-88	267	285	0.509	0.509	V9HW53_HUMAN dimethylargininase OS=Homo sapiens OX=9606 GN=HEL-S-277 PE=1 SV=1
9	Q5SRR8	2.52e-77	236	236	0.439	0.530	Q5SRR8_HUMAN dimethylargininase (Fragment) OS=Homo sapiens OX=9606 GN=DDAH2 PE=1 SV=2
10	Q5SSV3	1.83e-76	234	226	0.425	0.535	Q5SSV3_HUMAN dimethylargininase (Fragment) OS=Homo sapiens OX=9606 GN=DDAH2 PE=1 SV=1
11	P71889	0.005	40.0	302	0.116	0.109	DDAH_MYCTU N(G),N(G)-dimethylarginine dimethylaminohydrolase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2323c PE=1 SV=1
12	P9WQ05	0.014	38.9	402	0.119	0.085	ARCA_MYCTU Arginine deiminase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=arcA PE=1 SV=1
13	Q8CHG3	0.074	37.0	1680	0.091	0.015	GCC2_MOUSE GRIP and coiled-coil domain-containing protein 2 OS=Mus musculus OX=10090 GN=Gcc2 PE=1 SV=3
14	Q5E7U3	0.15	35.8	406	0.063	0.044	ARCA_ALIF1 Arginine deiminase OS=Aliivibrio fischeri (strain ATCC 700601 / ES114) OX=312309 GN=arcA PE=3 SV=1
15	Q12326	2.1	32.0	303	0.112	0.106	PMG3_YEAST Phosphoglycerate mutase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPM3 PE=1 SV=1
16	Q2QWU2	2.3	32.0	443	0.112	0.072	HDA10_ORYSJ Histone deacetylase 10, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=HDAC10 PE=1 SV=1
17	A0A8I5ZMW9	4.7	31.6	1704	0.147	0.025	A0A8I5ZMW9_RAT Polybromo 1 OS=Rattus norvegicus OX=10116 GN=Pbrm1 PE=1 SV=1
18	A0A8I6AV81	5.2	31.2	1624	0.147	0.026	A0A8I6AV81_RAT Polybromo 1 OS=Rattus norvegicus OX=10116 GN=Pbrm1 PE=1 SV=1
19	D3ZT52	5.2	31.2	1652	0.147	0.025	D3ZT52_RAT Polybromo 1 OS=Rattus norvegicus OX=10116 GN=Pbrm1 PE=1 SV=3
20	Q8BSQ9	5.3	31.2	1634	0.147	0.026	PB1_MOUSE Protein polybromo-1 OS=Mus musculus OX=10090 GN=Pbrm1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02274 ADI	0.002	28.8	Arginine deiminase
2	PF19420 DDAH_eukar	0.0028	28.5	N,N dimethylarginine dimethylhydrolase, eukaryotic

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010380857.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010354225.1	0.919	RAB28, member RAS oncogene family
2	61622.XP_010376612.1	0.919	Ras-related protein Rab-28-like
3	61622.XP_010382391.1	0.639	Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family
4	61622.XP_010373859.1	0.635	Beta-1,3-galactosyltransferase 2
5	61622.XP_010354065.1	0.620	Lysophospholipase II
6	61622.XP_010381626.1	0.600	Ski2 like RNA helicase
7	61622.XP_010364590.1	0.585	In the C-terminal section
8	61622.XP_010368677.1	0.585	Bromodomain testis-specific protein isoform X1
9	61622.XP_010367802.1	0.568	Belongs to the class I-like SAM-binding methyltransferase superfamily. Protein arginine N-methyltransferase family.
10	61622.XP_010351272.1	0.567	Zinc finger and BTB domain-containing protein 12
11	61622.XP_010378236.1	0.567	Produces nitric oxide (NO)
12	61622.XP_010381631.1	0.567	Zinc finger and BTB domain containing 12
13	61622.XP_010378423.1	0.546	Produces nitric oxide (NO)
14	61622.XP_010361066.1	0.545	Proline rich coiled-coil 2A
15	61622.XP_010352700.1	0.519	RAB40B, member RAS oncogene family
16	61622.XP_010357440.1	0.519	EF-hand calcium-binding domain-containing protein 4B
17	61622.XP_010357471.1	0.519	Ras and EF-hand domain-containing protein-like
18	61622.XP_010357566.1	0.519	Ras-related protein Rab-40A-like
19	61622.XP_010359103.1	0.519	Ras-related protein Rab-40A-like
20	61622.XP_010359803.1	0.519	RAB8A, member RAS oncogene family

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016403	1.000	dimethylargininase activity
GO:0005488	0.996	binding
GO:0043167	0.944	ion binding
GO:0005515	0.541	protein binding
GO:0043168	0.518	anion binding
GO:0036094	0.512	small molecule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0009987	0.986	cellular process
GO:0071704	0.947	organic substance metabolic process
GO:0006807	0.920	nitrogen compound metabolic process
GO:1901564	0.913	organonitrogen compound metabolic process
GO:0044237	0.905	cellular metabolic process
GO:0044238	0.903	primary metabolic process
GO:0048522	0.632	positive regulation of cellular process
GO:0044281	0.631	small molecule metabolic process
GO:0031323	0.628	regulation of cellular metabolic process
GO:0051171	0.607	regulation of nitrogen compound metabolic process
GO:0019752	0.558	carboxylic acid metabolic process
GO:0009893	0.521	positive regulation of metabolic process
GO:0051173	0.496	positive regulation of nitrogen compound metabolic process
GO:0031325	0.496	positive regulation of cellular metabolic process
GO:0031326	0.491	regulation of cellular biosynthetic process
GO:0050896	0.418	response to stimulus
GO:0031328	0.367	positive regulation of cellular biosynthetic process
GO:0032501	0.343	multicellular organismal process
GO:0006520	0.319	amino acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005829	0.996	cytosol
GO:0043231	0.991	intracellular membrane-bounded organelle
GO:0005576	0.983	extracellular region
GO:0031982	0.948	vesicle
GO:0005615	0.940	extracellular space
GO:0070062	0.933	extracellular exosome
GO:0005739	0.780	mitochondrion
GO:0016020	0.446	membrane
GO:0012505	0.393	endomembrane system
GO:0070013	0.389	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:17305	1.000	H2O + N(omega),N(omega)-dimethyl-L-arginine = dimethylamine + L-citrulline
EC:3.5.3.18	1.000	dimethylargininase.

[back to server]