StarFunc result for job id O94761

User Input

>input (1208 residues)
MERLRDVRERLQAWERAFRRQRGRRPSQDDVEAAPEETRALYREYRTLKRTTGQAGGGLR
SSESLPAAAEEAPEPRCWGPHLNRAATKSPQSTPGRSRQGSVPDYGQRLKANLKGTLQAG
PALGRRPWPLGRASSKASTPKPPGTGPVPSFAEKVSDEPPQLPEPQPRPGRLQHLQASLS
QRLGSLDPGWLQRCHSEVPDFLGAPKACRPDLGSEESQLLIPGESAVLGPGAGSQGPEAS
AFQEVSIRVGSPQPSSSGGEKRRWNEEPWESPAQVQQESSQAGPPSEGAGAVAVEEDPPG
EPVQAQPPQPCSSPSNPRYHGLSPSSQARAGKAEGTAPLHIFPRLARHDRGNYVRLNMKQ
KHYVRGRALRSRLLRKQAWKQKWRKKGECFGGGGATVTTKESCFLNEQFDHWAAQCPRPA
SEEDTDAVGPEPLVPSPQPVPEVPSLDPTVLPLYSLGPSGQLAETPAEVFQALEQLGHQA
FRPGQERAVMRILSGISTLLVLPTGAGKSLCYQLPALLYSRRSPCLTLVVSPLLSLMDDQ
VSGLPPCLKAACIHSGMTRKQRESVLQKIRAAQVHVLMLTPEALVGAGGLPPAAQLPPVA
FACIDEAHCLSQWSHNFRPCYLRVCKVLRERMGVHCFLGLTATATRRTASDVAQHLAVAE
EPDLHGPAPVPTNLHLSVSMDRDTDQALLTLLQGKRFQNLDSIIIYCNRREDTERIAALL
RTCLHAAWVPGSGGRAPKTTAEAYHAGMCSRERRRVQRAFMQGQLRVVVATVAFGMGLDR
PDVRAVLHLGLPPSFESYVQAVGRAGRDGQPAHCHLFLQPQGEDLRELRRHVHADSTDFL
AVKRLVQRVFPACTCTCTRPPSEQEGAVGGERPVPKYPPQEAEQLSHQAAPGPRRVCMGH
ERALPIQLTVQALDMPEEAIETLLCYLELHPHHWLELLATTYTHCRLNCPGGPAQLQALA
HRCPPLAVCLAQQLPEDPGQGSSSVEFDMVKLVDSMGWELASVRRALCQLQWDHEPRTGV
RRGTGVLVEFSELAFHLRSPGDLTAEEKDQICDFLYGRVQARERQALARLRRTFQAFHSV
AFPSCGPCLEQQDEERSTRLKDLLGRYFEEEEGQEPGGMEDAQGPEPGQARLQDWEDQVR
CDIRQFLSLRPEEKFSSRAVARIFHGIGSPCYPAQVYGQDRRFWRKYLHLSFHALVGLAT
EELLQVAR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O94761	1.000	1.000	0.000	1208	1.000	1.000	O94761.pdb.gz	RECQ4_HUMAN ATP-dependent DNA helicase Q4 OS=Homo sapiens OX=9606 GN=RECQL4 PE=1 SV=2
2	AFDB:Q75NR7	0.644	0.640	0.000	1216	0.649	0.645	Q75NR7.pdb.gz	RECQ4_MOUSE ATP-dependent DNA helicase Q4 OS=Mus musculus OX=10090 GN=Recql4 PE=2 SV=2
3	AFDB:P35187	0.277	0.233	3.355E-28	1447	0.148	0.124	P35187.pdb.gz	SGS1_YEAST ATP-dependent helicase SGS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SGS1 PE=1 SV=1
4	AFDB:Q588V7	0.242	0.144	2.316E-13	2154	0.166	0.093	Q588V7.pdb.gz	TEB_ARATH Helicase and polymerase-containing protein TEBICHI OS=Arabidopsis thaliana OX=3702 GN=TEB PE=2 SV=1
5	PDB:3ex7C	0.244	0.690	2.102E-12	392	0.054	0.166	3ex7C.pdb.gz	Mechanism of ATP turnover inhibition in the EJC
6	PDB:5dcaA	0.240	0.155	4.100E-12	1948	0.071	0.044	5dcaA.pdb.gz
7	PDB:7pliA	0.237	0.581	4.783E-12	457	0.065	0.173	7pliA.pdb.gz	Structural basis for RNA-duplex unwinding by the DEAD-box helicase DbpA.
8	PDB:7oqbp	0.136	0.331	3.932E-11	444	0.063	0.171	7oqbp.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
9	PDB:7evoE	0.136	0.333	4.357E-11	455	0.064	0.169	7evoE.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
10	PDB:7v2yF	0.198	0.509	1.044E-10	376	0.060	0.194	7v2yF.pdb.gz
11	PDB:2eyqA	0.204	0.213	1.574E-10	1146	0.055	0.058	2eyqA.pdb.gz
12	AFDB:Q8T145	0.219	0.152	3.595E-10	1789	0.101	0.068	Q8T145.pdb.gz	Q8T145_DICDI DNA helicase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274841 PE=3 SV=2
13	PDB:3jcmN	0.231	0.170	5.403E-10	1686	0.073	0.052	3jcmN.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
14	PDB:6qw65B	0.234	0.146	5.688E-10	2001	0.067	0.040	6qw65B.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
15	PDB:5zwny	0.127	0.344	1.168E-9	399	0.061	0.185	5zwny.pdb.gz	Structures of the fully assembledSaccharomyces cerevisiaespliceosome before activation
16	AFDB:Q3TKT4	0.206	0.158	1.078E-7	1613	0.108	0.081	Q3TKT4.pdb.gz	SMCA4_MOUSE Transcription activator BRG1 OS=Mus musculus OX=10090 GN=Smarca4 PE=1 SV=1
17	AFDB:A2AKX3	0.162	0.084	5.281E-2	2646	0.107	0.049	A2AKX3.pdb.gz	SETX_MOUSE Probable helicase senataxin OS=Mus musculus OX=10090 GN=Setx PE=1 SV=1
18	AFDB:B8QI36	0.032	0.033	1.476E-1	1187	0.063	0.064	B8QI36.pdb.gz	B8QI36_MOUSE Liprin-alpha 4 OS=Mus musculus OX=10090 GN=Ppfia4 PE=1 SV=1
19	AFDB:O64728	0.061	0.060	2.343E-1	1218	0.074	0.073	O64728.pdb.gz	STI_ARATH Protein STICHEL OS=Arabidopsis thaliana OX=3702 GN=STI PE=1 SV=2
20	AFDB:Q6FRZ8	0.048	0.082	4.341E-1	588	0.057	0.117	Q6FRZ8.pdb.gz	AP1_CANGA bZip transcription factor GAP1 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=AP1 PE=3 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O94761	0.0	2440	1208	1.000	1.000	RECQ4_HUMAN ATP-dependent DNA helicase Q4 OS=Homo sapiens OX=9606 GN=RECQL4 PE=1 SV=2
2	Q33DM4	0.0	919	1503	0.408	0.328	Q33DM4_XENLA RecQ4 protein OS=Xenopus laevis OX=8355 GN=XRecQ4 PE=2 SV=1
3	Q4JNX8	0.0	928	1500	0.407	0.328	Q4JNX8_XENLA RECQL4-helicase-like protein OS=Xenopus laevis OX=8355 GN=recql4.L PE=2 SV=1
4	Q75NR7	0.0	1444	1216	0.656	0.651	RECQ4_MOUSE ATP-dependent DNA helicase Q4 OS=Mus musculus OX=10090 GN=Recql4 PE=2 SV=2
5	Q9NH11	0.0	625	1530	0.267	0.211	Q9NH11_DROME DNA helicase OS=Drosophila melanogaster OX=7227 GN=RecQ4 PE=3 SV=1
6	Q9VSE6	0.0	625	1579	0.267	0.205	Q9VSE6_DROME DNA helicase OS=Drosophila melanogaster OX=7227 GN=RecQ4 PE=1 SV=1
7	Q0WVW7	4.63e-89	310	911	0.195	0.258	RQL5_ARATH ATP-dependent DNA helicase Q-like 5 OS=Arabidopsis thaliana OX=3702 GN=RECQL5 PE=2 SV=2
8	P15043	6.87e-67	239	609	0.124	0.246	RECQ_ECOLI ATP-dependent DNA helicase RecQ OS=Escherichia coli (strain K12) OX=83333 GN=recQ PE=1 SV=5
9	Q09811	2.64e-54	210	1328	0.113	0.102	HUS2_SCHPO ATP-dependent DNA helicase hus2/rqh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rqh1 PE=1 SV=1
10	Q19546	3.49e-54	209	1056	0.108	0.123	WRN_CAEEL ATP-dependent helicase wrn-1 OS=Caenorhabditis elegans OX=6239 GN=wrn-1 PE=3 SV=2
11	O34748	2.06e-52	197	591	0.097	0.198	RECQ_BACSU Probable ATP-dependent DNA helicase RecQ OS=Bacillus subtilis (strain 168) OX=224308 GN=recQ PE=3 SV=1
12	P35187	1.95e-51	201	1447	0.103	0.086	SGS1_YEAST ATP-dependent helicase SGS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SGS1 PE=1 SV=1
13	Q54DM3	2.44e-50	197	1259	0.107	0.102	Q54DM3_DICDI DNA helicase OS=Dictyostelium discoideum OX=44689 GN=blm PE=3 SV=1
14	O18017	8.04e-50	194	988	0.108	0.132	BLM_CAEEL RecQ-like DNA helicase blm-1 OS=Caenorhabditis elegans OX=6239 GN=him-6 PE=1 SV=2
15	Q9FT70	1.30e-49	194	1150	0.109	0.115	RQL4B_ARATH ATP-dependent DNA helicase Q-like 4B OS=Arabidopsis thaliana OX=3702 GN=RECQL4B PE=2 SV=1
16	O94762	1.48e-49	194	991	0.111	0.135	RECQ5_HUMAN ATP-dependent DNA helicase Q5 OS=Homo sapiens OX=9606 GN=RECQL5 PE=1 SV=2
17	Q9FT74	2.61e-49	188	606	0.115	0.229	RQL1_ARATH ATP-dependent DNA helicase Q-like 1 OS=Arabidopsis thaliana OX=3702 GN=RECQL1 PE=2 SV=1
18	Q5A5R4	3.19e-49	193	1189	0.100	0.102	Q5A5R4_CANAL DNA helicase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SGS1 PE=3 SV=1
19	Q9FT73	3.78e-49	189	705	0.099	0.170	RECQ2_ARATH ATP-dependent DNA helicase Q-like 2 OS=Arabidopsis thaliana OX=3702 GN=RECQL2 PE=1 SV=1
20	E7EZY7	6.06e-49	193	1420	0.112	0.095	E7EZY7_DANRE DNA helicase OS=Danio rerio OX=7955 GN=blm PE=3 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00270 DEAD	7.4e-13	60.1	DEAD/DEAH box helicase
2	PF11719 Drc1-Sld2	5.9e-05	34.4	DNA replication and checkpoint protein
3	PF00271 Helicase_C	7.9e-16	69.8	Helicase conserved C-terminal domain
4	PF04851 ResIII	47	15.4	Type III restriction enzyme, res subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000482313

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000418268	0.996	Protein MCM10 homolog
2	9606.ENSP00000265056	0.973	DNA replication licensing factor MCM2
3	9606.ENSP00000405726	0.965	Cell division control protein 45 homolog
4	9606.ENSP00000267430	0.962	Fanconi anemia group M protein
5	9606.ENSP00000260810	0.954	DNA topoisomerase 2-binding protein 1
6	9606.ENSP00000442336	0.947	DNA topoisomerase 3-alpha
7	9606.ENSP00000372088	0.943	DNA repair protein RAD51 homolog 1
8	9606.ENSP00000364270	0.937	DNA repair protein complementing XP-A cells
9	9606.ENSP00000290650	0.934	E3 ubiquitin-protein ligase UBR1
10	9606.ENSP00000355506	0.931	Exonuclease 1
11	9606.ENSP00000261881	0.923	TIMELESS-interacting protein
12	9606.ENSP00000307853	0.920	Crossover junction endonuclease MUS81
13	9606.ENSP00000450607	0.915	Protein timeless homolog
14	9606.ENSP00000328174	0.909	ATP-dependent DNA helicase PIF1
15	9606.ENSP00000305480	0.905	Flap endonuclease 1
16	9606.ENSP00000369335	0.897	F-box DNA helicase 1
17	9606.ENSP00000343741	0.896	Serine/threonine-protein kinase ATR
18	9606.ENSP00000234420	0.888	DNA mismatch repair protein Msh6
19	9606.ENSP00000268138	0.887	Treslin
20	9606.ENSP00000276603	0.878	Telomeric repeat-binding factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004386	0.999	helicase activity
GO:0003684	0.999	damaged DNA binding
GO:0000217	0.999	DNA secondary structure binding
GO:1990814	0.999	DNA/DNA annealing activity
GO:0003723	0.746	RNA binding
GO:0061821	0.572	telomeric D-loop binding
GO:0032357	0.555	oxidized purine DNA binding
GO:0000405	0.553	bubble DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043170	0.996	macromolecule metabolic process
GO:0006139	0.995	nucleobase-containing compound metabolic process
GO:0006259	0.989	DNA metabolic process
GO:0006974	0.987	cellular response to DNA damage stimulus
GO:0006996	0.951	organelle organization
GO:0051276	0.937	chromosome organization
GO:0071103	0.916	DNA conformation change
GO:0006281	0.915	DNA repair
GO:0032392	0.905	DNA geometric change
GO:0032508	0.889	DNA duplex unwinding
GO:0065007	0.798	biological regulation
GO:0050789	0.777	regulation of biological process
GO:0050794	0.768	regulation of cellular process
GO:0032200	0.764	telomere organization
GO:0006260	0.717	DNA replication
GO:0000723	0.435	telomere maintenance
GO:0048518	0.382	positive regulation of biological process
GO:0048519	0.348	negative regulation of biological process
GO:0048522	0.339	positive regulation of cellular process
GO:0060255	0.325	regulation of macromolecule metabolic process
GO:0048523	0.315	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005694	0.996	chromosome
GO:0016020	0.992	membrane
GO:0098687	0.933	chromosomal region
GO:0032991	0.920	protein-containing complex
GO:0000781	0.847	chromosome, telomeric region
GO:0005737	0.760	cytoplasm
GO:0005829	0.460	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]