StarFunc result for job id O94762

User Input

>input (991 residues)
MSSHHTTFPFDPERRVRSTLKKVFGFDSFKTPLQESATMAVVKGNKDVFVCMPTGAGKSL
CYQLPALLAKGITIVVSPLIALIQDQVDHLLTLKVRVSSLNSKLSAQERKELLADLEREK
PQTKILYITPEMAASSSFQPTLNSLVSRHLLSYLVVDEAHCVSQWGHDFRPDYLRLGALR
SRLGHAPCVALTATATPQVQEDVFAALHLKKPVAIFKTPCFRANLFYDVQFKELISDPYG
NLKDFCLKALGQEADKGLSGCGIVYCRTREACEQLAIELSCRGVNAKAYHAGLKASERTL
VQNDWMEEKVPVIVATISFGMGVDKANVRFVAHWNIAKSMAGYYQESGRAGRDGKPSWCR
LYYSRNDRDQVSFLIRKEVAKLQEKRGNKASDKATIMAFDALVTFCEELGCRHAAIAKYF
GDALPACAKGCDHCQNPTAVRRRLEALERSSSWSKTCIGPSQGNGFDPELYEGGRKGYGD
FSRYDEGSGGSGDEGRDEAHKREWNLFYQKQMQLRKGKDPKIEEFVPPDENCPLKEASSR
RIPRLTVKAREHCLRLLEEALSSNRQSTRTADEADLRAKAVELEHETFRNAKVANLYKAS
VLKKVADIHRASKDGQPYDMGGSAKSCSAQAEPPEPNEYDIPPASHVYSLKPKRVGAGFP
KGSCPFQTATELMETTRIREQAPQPERGGEHEPPSRPCGLLDEDGSEPLPGPRGEVPGGS
AHYGGPSPEKKAKSSSGGSSLAKGRASKKQQLLATAAHKDSQSIARFFCRRVESPALLAS
APEAEGACPSCEGVQGPPMAPEKYTGEEDGAGGHSPAPPQTEECLRERPSTCPPRDQGTP
EVQPTPAKDTWKGKRPRSQQENPESQPQKRPRPSAKPSVVAEVKGSVSASEQGTLNPTAQ
DPFQLSAPGVSLKEAANVVVKCLTPFYKEGKFASKELFKGFARHLSHLLTQKTSPGRSVK
EEAQNLIRHFFHGRARCESEADWHGLCGPQR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R8M9	0.543	0.543	0.000	991	1.000	1.000	A0A024R8M9.pdb.gz
2	AFDB:Q8VID5	0.610	0.615	0.000	982	0.788	0.795	Q8VID5.pdb.gz	RECQ5_MOUSE ATP-dependent DNA helicase Q5 OS=Mus musculus OX=10090 GN=Recql5 PE=1 SV=1
3	AFDB:X1WCM8	0.459	0.487	2.158E-78	933	0.468	0.497	X1WCM8.pdb.gz	X1WCM8_DANRE ATP-dependent DNA helicase OS=Danio rerio OX=7955 GN=recql5 PE=3 SV=1
4	AFDB:A0A2R8Q310	0.453	0.510	5.812E-72	875	0.451	0.511	A0A2R8Q310.pdb.gz
5	AFDB:Q19046	0.442	0.529	5.056E-48	821	0.246	0.297	Q19046.pdb.gz	Q19046_CAEEL ATP-dependent DNA helicase OS=Caenorhabditis elegans OX=6239 GN=rcq-5 PE=1 SV=2
6	AFDB:Q9FT72	0.420	0.578	3.107E-44	713	0.224	0.311	Q9FT72.pdb.gz	RQL3_ARATH ATP-dependent DNA helicase Q-like 3 OS=Arabidopsis thaliana OX=3702 GN=RECQL3 PE=1 SV=1
7	AFDB:Q8IYD8	0.285	0.145	3.792E-13	2048	0.146	0.071	Q8IYD8.pdb.gz	FANCM_HUMAN Fanconi anemia group M protein OS=Homo sapiens OX=9606 GN=FANCM PE=1 SV=2
8	PDB:7evoE	0.159	0.324	1.054E-12	455	0.073	0.158	7evoE.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
9	PDB:7pliA	0.283	0.566	1.158E-12	457	0.071	0.153	7pliA.pdb.gz	Structural basis for RNA-duplex unwinding by the DEAD-box helicase DbpA.
10	PDB:2eyqA	0.260	0.230	1.688E-12	1146	0.091	0.079	2eyqA.pdb.gz
11	PDB:5dcaA	0.261	0.140	2.039E-12	1948	0.096	0.049	5dcaA.pdb.gz
12	PDB:7v2yF	0.245	0.533	4.545E-12	376	0.074	0.194	7v2yF.pdb.gz
13	PDB:5zwny	0.154	0.345	6.947E-12	399	0.084	0.208	5zwny.pdb.gz	Structures of the fully assembledSaccharomyces cerevisiaespliceosome before activation
14	AFDB:Q8CGS6	0.286	0.118	7.754E-12	2544	0.180	0.070	Q8CGS6.pdb.gz	DPOLQ_MOUSE DNA polymerase theta OS=Mus musculus OX=10090 GN=Polq PE=1 SV=2
15	PDB:7oqbp	0.164	0.336	1.702E-11	444	0.074	0.164	7oqbp.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
16	PDB:3ex7C	0.283	0.643	1.960E-11	392	0.055	0.140	3ex7C.pdb.gz	Mechanism of ATP turnover inhibition in the EJC
17	PDB:6qw65X	0.179	0.278	1.960E-11	583	0.076	0.129	6qw65X.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
18	PDB:6xeoA	0.285	0.255	2.601E-11	1118	0.091	0.081	6xeoA.pdb.gz	Molecular determinants for dsDNA translocation by the transcription-repair coupling and evolvability factor Mfd.
19	AFDB:Q00416	0.208	0.105	3.855E-5	2231	0.120	0.053	Q00416.pdb.gz	SEN1_YEAST Helicase SEN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEN1 PE=1 SV=2
20	AFDB:Q22308	0.288	0.280	4.693E-4	1022	0.073	0.070	Q22308.pdb.gz	Q22308_CAEEL RNA helicase OS=Caenorhabditis elegans OX=6239 GN=ddx-19 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O94762	0.0	2048	991	1.000	1.000	RECQ5_HUMAN ATP-dependent DNA helicase Q5 OS=Homo sapiens OX=9606 GN=RECQL5 PE=1 SV=2
2	Q8VID5	0.0	1511	982	0.788	0.795	RECQ5_MOUSE ATP-dependent DNA helicase Q5 OS=Mus musculus OX=10090 GN=Recql5 PE=1 SV=1
3	X1WCM8	0.0	791	933	0.468	0.497	X1WCM8_DANRE ATP-dependent DNA helicase OS=Danio rerio OX=7955 GN=recql5 PE=3 SV=1
4	Q9Y1H2	8.21e-157	492	1057	0.271	0.254	Q9Y1H2_DROME DNA helicase OS=Drosophila melanogaster OX=7227 GN=RecQ5 PE=3 SV=1
5	Q9V433	1.96e-156	491	1058	0.271	0.254	Q9V433_DROME DNA helicase OS=Drosophila melanogaster OX=7227 GN=RecQ5 PE=2 SV=1
6	Q9U5E0	2.66e-156	491	1058	0.271	0.254	Q9U5E0_DROME DNA helicase OS=Drosophila melanogaster OX=7227 GN=RecQ5 PE=3 SV=1
7	Q9UA31	2.33e-145	443	468	0.223	0.472	Q9UA31_DROME ATP-dependent DNA helicase OS=Drosophila melanogaster OX=7227 GN=RecQ5 PE=3 SV=1
8	Q59E27	2.71e-145	442	468	0.223	0.472	Q59E27_DROME ATP-dependent DNA helicase OS=Drosophila melanogaster OX=7227 GN=RecQ5 PE=3 SV=1
9	Q9UA32	2.92e-145	442	470	0.223	0.470	Q9UA32_DROME ATP-dependent DNA helicase OS=Drosophila melanogaster OX=7227 GN=RecQ5 PE=3 SV=1
10	Q7YZ98	3.18e-145	442	470	0.223	0.470	Q7YZ98_DROME ATP-dependent DNA helicase OS=Drosophila melanogaster OX=7227 GN=RecQ5 PE=3 SV=1
11	Q19046	1.08e-131	419	821	0.245	0.296	Q19046_CAEEL ATP-dependent DNA helicase OS=Caenorhabditis elegans OX=6239 GN=rcq-5 PE=1 SV=2
12	J3QLU0	2.06e-129	390	190	0.192	1.000	J3QLU0_HUMAN RecQ like helicase 5 (Fragment) OS=Homo sapiens OX=9606 GN=RECQL5 PE=1 SV=1
13	Q9FT72	8.80e-112	363	713	0.229	0.318	RQL3_ARATH ATP-dependent DNA helicase Q-like 3 OS=Arabidopsis thaliana OX=3702 GN=RECQL3 PE=1 SV=1
14	Q9VGI8	2.47e-93	327	1487	0.189	0.126	BLM_DROME RecQ-like DNA helicase Blm OS=Drosophila melanogaster OX=7227 GN=Blm PE=1 SV=1
15	E7EZY7	1.78e-91	321	1420	0.188	0.131	E7EZY7_DANRE DNA helicase OS=Danio rerio OX=7955 GN=blm PE=3 SV=3
16	Q09811	1.85e-91	320	1328	0.182	0.136	HUS2_SCHPO ATP-dependent DNA helicase hus2/rqh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rqh1 PE=1 SV=1
17	Q54DM3	2.38e-91	319	1259	0.188	0.148	Q54DM3_DICDI DNA helicase OS=Dictyostelium discoideum OX=44689 GN=blm PE=3 SV=1
18	Q5A5R4	8.82e-91	317	1189	0.175	0.146	Q5A5R4_CANAL DNA helicase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SGS1 PE=3 SV=1
19	Q9FT70	1.07e-89	313	1150	0.189	0.163	RQL4B_ARATH ATP-dependent DNA helicase Q-like 4B OS=Arabidopsis thaliana OX=3702 GN=RECQL4B PE=2 SV=1
20	Q6FLV3	2.97e-89	314	1371	0.174	0.125	Q6FLV3_CANGA Candida glabrata strain CBS138 chromosome L complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0L00407g PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13401 AAA_22	2e+02	13.7	AAA domain
2	PF00270 DEAD	1e-17	76.0	DEAD/DEAH box helicase
3	PF00271 Helicase_C	8.7e-13	60.0	Helicase conserved C-terminal domain
4	PF16987 KIX_2	5.3e+02	12.1	KIX domain
5	PF01993 MTD	2.7e+02	12.3	methylene-5,6,7,8-tetrahydromethanopterin dehydrogenase
6	PF06959 RecQ5	1.2e-105	363.6	RecQ helicase protein-like 5 (RecQ5)
7	PF16124 RecQ_Zn_bind	1e-06	40.6	RecQ zinc-binding
8	PF04851 ResIII	0.11	24.0	Type III restriction enzyme, res subunit
9	PF08236 SRI	7.2	18.2	SRI (Set2 Rpb1 interacting) domain
10	PF07500 TFIIS_M	19	17.1	Transcription factor S-II (TFIIS), central domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000317636

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000372088	0.993	DNA repair protein RAD51 homolog 1
2	9606.ENSP00000480158	0.954	DNA-directed RNA polymerase II subunit RPB1
3	9606.ENSP00000307853	0.944	Crossover junction endonuclease MUS81
4	9606.ENSP00000267430	0.932	Fanconi anemia group M protein
5	9606.ENSP00000442336	0.908	DNA topoisomerase 3-alpha
6	9606.ENSP00000362532	0.897	Regulation of nuclear pre-mRNA domain-containing protein 1B
7	9606.ENSP00000301788	0.890	DNA-directed RNA polymerase II subunit RPB7
8	9606.ENSP00000369335	0.875	F-box DNA helicase 1
9	9606.ENSP00000299638	0.864	DNA-directed RNA polymerase II subunit GRINL1A
10	9606.ENSP00000305480	0.853	Flap endonuclease 1
11	9606.ENSP00000272645	0.821	DNA-directed RNA polymerase II subunit RPB4
12	9606.ENSP00000371475	0.806	TP53-binding protein 1
13	9606.ENSP00000351284	0.805	DNA repair protein RAD52 homolog
14	9606.ENSP00000353332	0.801	Regulator of telomere elongation helicase 1
15	9606.ENSP00000317039	0.800	RecQ-mediated genome instability protein 1
16	9606.ENSP00000368881	0.754	DNA/RNA-binding protein KIN17
17	9606.ENSP00000336606	0.736	DNA repair and recombination protein RAD54B
18	9606.ENSP00000364498	0.736	Decapping and exoribonuclease protein
19	9606.ENSP00000328174	0.729	ATP-dependent DNA helicase PIF1
20	9606.ENSP00000325863	0.723	Double-strand break repair protein MRE11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003678	0.999	DNA helicase activity
GO:1901363	0.998	heterocyclic compound binding
GO:0097159	0.998	organic cyclic compound binding
GO:0019899	0.995	enzyme binding
GO:0003676	0.993	nucleic acid binding
GO:0000993	0.977	RNA polymerase II complex binding
GO:0003677	0.947	DNA binding
GO:0042802	0.831	identical protein binding
GO:0016787	0.550	hydrolase activity
GO:0043167	0.350	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0006259	0.996	DNA metabolic process
GO:0019222	0.995	regulation of metabolic process
GO:0006974	0.995	cellular response to DNA damage stimulus
GO:0060255	0.994	regulation of macromolecule metabolic process
GO:0019219	0.994	regulation of nucleobase-containing compound metabolic process
GO:0048523	0.979	negative regulation of cellular process
GO:0006281	0.978	DNA repair
GO:0010605	0.944	negative regulation of macromolecule metabolic process
GO:0031324	0.837	negative regulation of cellular metabolic process
GO:0051172	0.833	negative regulation of nitrogen compound metabolic process
GO:0045934	0.769	negative regulation of nucleobase-containing compound metabolic process
GO:0007049	0.717	cell cycle
GO:0022402	0.682	cell cycle process
GO:0051052	0.635	regulation of DNA metabolic process
GO:0006302	0.501	double-strand break repair
GO:0000278	0.411	mitotic cell cycle
GO:0007059	0.316	chromosome segregation
GO:0071840	0.302	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.996	cytosol
GO:0032991	0.960	protein-containing complex
GO:0043232	0.957	intracellular non-membrane-bounded organelle
GO:0005694	0.869	chromosome
GO:0140513	0.522	nuclear protein-containing complex
GO:1902494	0.469	catalytic complex
GO:0016020	0.464	membrane
GO:1990234	0.412	transferase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.550	Hydrolases.

[back to server]