StarFunc result for job id O94763

User Input

>input (535 residues)
MEAPTVETPPDPSPPSAPAPALVPLRAPDVARLREEQEKVVTNCQERIQHWKKVDNDYNA
LRERLSTLPDKLSYNIMVPFGPFAFMPGKLVHTNEVTVLLGDNWFAKCSAKQAVGLVEHR
KEHVRKTIDDLKKVMKNFESRVEFTEDLQKMSDAAGDIVDIREEIKCDFEFKAKHRIAHK
PHSKPKTSDIFEADIANDVKSKDLLADKELWARLEELERQEELLGELDSKPDTVIANGED
TTSSEEEKEDRNTNVNAMHQVTDSHTPCHKDVASSEPFSGQVNSQLNCSVNGSSSYHSDD
DDDDDDDDDDDNIDDDDGDNDHEALGVGDNSIPTIYFSHTVEPKRVRINTGKNTTLKFSE
KKEEAKRKRKNSTGSGHSAQELPTIRTPADIYRAFVDVVNGEYVPRKSILKSRSRENSVC
SDTSESSAAEFDDRRGVLRSISCEEATCSDTSESILEEEPQENQKKLLPLSVTPEAFSGT
VIEKEFVSPSLTPPPAIAHPALPTIPERKEVLLEASEETGKRVSKFKAARLQQKD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O94763	1.000	1.000	2.236E-79	535	1.000	1.000	O94763.pdb.gz	RMP_HUMAN Unconventional prefoldin RPB5 interactor 1 OS=Homo sapiens OX=9606 GN=URI1 PE=1 SV=3
2	PDB:2zdiC	0.224	0.746	2.033E-6	148	0.049	0.176	2zdiC.pdb.gz
3	AFDB:O42131	0.061	0.028	7.068E-2	1627	0.127	0.042	O42131.pdb.gz	TOP2B_CHICK DNA topoisomerase 2-beta OS=Gallus gallus OX=9031 GN=TOP2B PE=2 SV=1
4	AFDB:A0A0B4JCT7	0.121	0.121	8.523E-2	537	0.157	0.156	A0A0B4JCT7.pdb.gz	A0A0B4JCT7_DROME Jabba, isoform F OS=Drosophila melanogaster OX=7227 GN=Jabba PE=1 SV=1
5	PDB:2zdiB	0.177	0.834	9.908E-2	106	0.026	0.132	2zdiB.pdb.gz
6	PDB:7aqcR	0.159	0.153	1.968E-1	558	0.017	0.016	7aqcR.pdb.gz	Mimicry of Canonical Translation Elongation Underlies Alanine Tail Synthesis in RQC.
7	AFDB:O42130	0.064	0.028	4.317E-1	1553	0.110	0.038	O42130.pdb.gz	TOP2A_CHICK DNA topoisomerase 2-alpha OS=Gallus gallus OX=9031 GN=TOP2A PE=2 SV=2
8	AFDB:Q52KP9	0.068	0.057	4.317E-1	679	0.151	0.119	Q52KP9.pdb.gz	Q52KP9_MOUSE Kidins220 protein (Fragment) OS=Mus musculus OX=10090 GN=Kidins220 PE=2 SV=1
9	PDB:7khwA	0.111	0.221	4.715E-1	174	0.036	0.109	7khwA.pdb.gz
10	AFDB:O08934	0.066	0.066	5.540E-1	530	0.092	0.092	O08934.pdb.gz	UNC4_MOUSE Homeobox protein unc-4 homolog OS=Mus musculus OX=10090 GN=Uncx PE=2 SV=2
11	AFDB:Q382R7	0.067	0.042	6.277E-1	974	0.129	0.071	Q382R7.pdb.gz	Q382R7_TRYB2 PH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.4480 PE=4 SV=1
12	AFDB:Q8N944	0.070	0.048	6.681E-1	861	0.105	0.065	Q8N944.pdb.gz	AMER3_HUMAN APC membrane recruitment protein 3 OS=Homo sapiens OX=9606 GN=AMER3 PE=1 SV=2
13	AFDB:Q76KD6	0.087	0.093	7.111E-1	591	0.110	0.100	Q76KD6.pdb.gz	SPERI_HUMAN Speriolin OS=Homo sapiens OX=9606 GN=SPATC1 PE=2 SV=2
14	AFDB:G5EGK6	0.073	0.021	7.569E-1	2407	0.140	0.031	G5EGK6.pdb.gz	DIN1_CAEEL Daf-12-interacting protein 1 OS=Caenorhabditis elegans OX=6239 GN=din-1 PE=1 SV=1
15	PDB:5wk5A	0.089	0.170	8.267E-1	269	0.039	0.078	5wk5A.pdb.gz
16	PDB:6vq6H	0.116	0.230	2.879	214	0.024	0.061	6vq6H.pdb.gz	Structure of V-ATPase from the mammalian brain.
17	PDB:2b5uA	0.140	0.156	3.472	470	0.036	0.040	2b5uA.pdb.gz
18	PDB:7o4iW	0.060	0.092	3.696	312	0.062	0.106	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
19	PDB:1serB	0.088	0.108	3.933	421	0.032	0.040	1serB.pdb.gz	The 2.9 A crystal structure of T. thermophilus seryl-tRNA synthetase complexed with tRNA(Ser).
20	PDB:2w6gG	0.089	0.306	3.933	140	0.026	0.100	2w6gG.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O94763	0.0	1097	535	1.000	1.000	RMP_HUMAN Unconventional prefoldin RPB5 interactor 1 OS=Homo sapiens OX=9606 GN=URI1 PE=1 SV=3
2	Q6NX55	0.0	983	494	0.905	0.980	Q6NX55_HUMAN Chromosome 19 open reading frame 2 OS=Homo sapiens OX=9606 GN=C19orf2 PE=1 SV=1
3	Q9W148	1.34e-07	57.0	731	0.050	0.037	URI_DROME Unconventional prefoldin RPB5 interactor-like protein OS=Drosophila melanogaster OX=7227 GN=uri PE=1 SV=1
4	Q381I2	7.32e-07	53.9	411	0.049	0.063	Q381I2_TRYB2 Prefoldin subunit OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.7700 PE=4 SV=1
5	Q9VCZ8	2.03e-04	44.3	168	0.054	0.173	PFD5_DROME Probable prefoldin subunit 5 OS=Drosophila melanogaster OX=7227 GN=Pfdn5 PE=1 SV=1
6	Q966M4	0.001	44.3	446	0.071	0.085	Q966M4_CAEEL Unconventional prefoldin RPB5 interactor OS=Caenorhabditis elegans OX=6239 GN=uri-1 PE=1 SV=1
7	Q9LKF9	1.1	34.7	739	0.050	0.037	CPSF2_ARATH Cleavage and polyadenylation specificity factor subunit 2 OS=Arabidopsis thaliana OX=3702 GN=CPSF100 PE=1 SV=2
8	Q8HYI9	5.2	31.2	154	0.049	0.169	PFD5_BOVIN Prefoldin subunit 5 OS=Bos taurus OX=9913 GN=PFDN5 PE=2 SV=1
9	Q9WU28	7.1	30.8	154	0.049	0.169	PFD5_MOUSE Prefoldin subunit 5 OS=Mus musculus OX=10090 GN=Pfdn5 PE=1 SV=1
10	Q99471	7.5	30.8	154	0.049	0.169	PFD5_HUMAN Prefoldin subunit 5 OS=Homo sapiens OX=9606 GN=PFDN5 PE=1 SV=2
11	Q9XI75	7.7	31.6	308	0.069	0.120	Q9XI75_ARATH 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=DAO1 PE=1 SV=1
12	B5DFN4	8.1	30.4	154	0.049	0.169	B5DFN4_RAT Prefoldin 5 (Predicted), isoform CRA_a OS=Rattus norvegicus OX=10116 GN=Pfdn5 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18757 Nmad5	91	14.6	Nucleotide modification associated domain 5
2	PF02996 Prefoldin	7.7e-12	56.6	Prefoldin subunit
3	PF13758 Prefoldin_3	8.4e-06	37.1	Prefoldin subunit
4	PF10368 YkyA	4.3e+02	12.0	Putative cell-wall binding lipoprotein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000376097

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000478303	0.998	DNA-directed RNA polymerases I, II, and III subunit RPABC1
2	9606.ENSP00000337393	0.986	Protein UXT
3	9606.ENSP00000341779	0.982	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
4	9606.ENSP00000356989	0.981	Prefoldin subunit 2
5	9606.ENSP00000202017	0.979	P53 and DNA damage-regulated protein 1
6	9606.ENSP00000378563	0.950	Prefoldin subunit 6
7	9606.ENSP00000318297	0.949	RuvB-like 1
8	9606.ENSP00000005386	0.948	RNA polymerase II-associated protein 3
9	9606.ENSP00000473172	0.945	RuvB-like 2
10	9606.ENSP00000262265	0.933	PIH1 domain-containing protein 1
11	9606.ENSP00000295121	0.914	Uncharacterized protein DKFZp434B156
12	9606.ENSP00000326031	0.899	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
13	9606.ENSP00000447942	0.826	Prefoldin subunit 5
14	9606.ENSP00000360473	0.824	Prefoldin subunit 4
15	9606.ENSP00000361363	0.779	DNA methyltransferase 1-associated protein 1
16	9606.ENSP00000230859	0.756	Non-canonical poly(A) RNA polymerase PAPD7
17	9606.ENSP00000480158	0.750	DNA-directed RNA polymerase II subunit RPB1
18	9606.ENSP00000263857	0.725	DNA-directed RNA polymerase I subunit RPA1
19	9606.ENSP00000305682	0.689	Mitochondrial ribosomal protein L39
20	9606.ENSP00000361446	0.654	DNA-directed RNA polymerase III subunit RPC1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003712	0.995	transcription coregulator activity
GO:0019899	0.995	enzyme binding
GO:0003714	0.994	transcription corepressor activity
GO:0003682	0.993	chromatin binding
GO:0051219	0.993	phosphoprotein binding
GO:0000993	0.993	RNA polymerase II complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0048583	0.969	regulation of response to stimulus
GO:2001141	0.969	regulation of RNA biosynthetic process
GO:0051172	0.965	negative regulation of nitrogen compound metabolic process
GO:0010468	0.957	regulation of gene expression
GO:0050896	0.954	response to stimulus
GO:0006355	0.953	regulation of DNA-templated transcription
GO:0048523	0.947	negative regulation of cellular process
GO:0010605	0.941	negative regulation of macromolecule metabolic process
GO:0023051	0.926	regulation of signaling
GO:0010646	0.926	regulation of cell communication
GO:0031324	0.881	negative regulation of cellular metabolic process
GO:0009966	0.853	regulation of signal transduction
GO:0051128	0.833	regulation of cellular component organization
GO:0010941	0.802	regulation of cell death
GO:0051174	0.798	regulation of phosphorus metabolic process
GO:0051253	0.797	negative regulation of RNA metabolic process
GO:0009719	0.750	response to endogenous stimulus
GO:0019220	0.721	regulation of phosphate metabolic process
GO:0045892	0.703	negative regulation of DNA-templated transcription
GO:0044092	0.694	negative regulation of molecular function
GO:0010648	0.682	negative regulation of cell communication
GO:0042221	0.678	response to chemical
GO:0042981	0.663	regulation of apoptotic process
GO:0009968	0.640	negative regulation of signal transduction
GO:2001233	0.622	regulation of apoptotic signaling pathway
GO:0010033	0.611	response to organic substance
GO:0006357	0.590	regulation of transcription by RNA polymerase II
GO:1902531	0.580	regulation of intracellular signal transduction
GO:0008152	0.564	metabolic process
GO:0035303	0.527	regulation of dephosphorylation
GO:0014070	0.513	response to organic cyclic compound
GO:0051716	0.484	cellular response to stimulus
GO:0060548	0.480	negative regulation of cell death
GO:0045936	0.455	negative regulation of phosphate metabolic process
GO:2001242	0.445	regulation of intrinsic apoptotic signaling pathway
GO:0033993	0.437	response to lipid
GO:0009725	0.431	response to hormone
GO:0043066	0.425	negative regulation of apoptotic process
GO:2001234	0.409	negative regulation of apoptotic signaling pathway
GO:0071704	0.353	organic substance metabolic process
GO:0048518	0.351	positive regulation of biological process
GO:0048522	0.326	positive regulation of cellular process
GO:0044237	0.313	cellular metabolic process
GO:0009605	0.309	response to external stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:1990062	0.697	RPAP3/R2TP/prefoldin-like complex
GO:0043232	0.651	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]