StarFunc result for job id O94766

User Input

>input (335 residues)
MKLKLKNVFLAYFLVSIAGLLYALVQLGQPCDCLPPLRAAAEQLRQKDLRISQLQAELRR
PPPAPAQPPEPEALPTIYVVTPTYARLVQKAELVRLSQTLSLVPRLHWLLVEDAEGPTPL
VSGLLAASGLLFTHLVVLTPKAQRLREGEPGWVHPRGVEQRNKALDWLRGRGGAVGGEKD
PPPPGTQGVVYFADDDNTYSRELFEEMRWTRGVSVWPVGLVGGLRFEGPQVQDGRVVGFH
TAWEPSRPFPVDMAGFAVALPLLLDKPNAQFDSTAPRGHLESSLLSHLVDPKDLEPRAAN
CTRVLVWHTRTEKPKMKQEEQLQRQGRGSDPAIEV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O94766	1.000	1.000	2.571E-73	335	1.000	1.000	O94766.pdb.gz	B3GA3_HUMAN Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3 OS=Homo sapiens OX=9606 GN=B3GAT3 PE=1 SV=2
2	AFDB:F8W289	0.760	0.771	3.081E-46	330	0.582	0.591	F8W289.pdb.gz	F8W289_DANRE Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase OS=Danio rerio OX=7955 GN=CHUNP6865 PE=3 SV=1
3	AFDB:Q5CB07	0.708	0.725	1.791E-41	327	0.499	0.511	Q5CB07.pdb.gz
4	AFDB:O35789	0.722	0.724	1.108E-36	334	0.448	0.449	O35789.pdb.gz	B3GA1_RAT Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=B3gat1 PE=1 SV=2
5	AFDB:O97422	0.744	0.814	1.510E-36	306	0.406	0.444	O97422.pdb.gz	B3GI_DROME Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase I OS=Drosophila melanogaster OX=7227 GN=GlcAT-I PE=2 SV=2
6	AFDB:Q09363	0.692	0.652	2.986E-36	356	0.394	0.371	Q09363.pdb.gz	SQV8_CAEEL Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase sqv-8 OS=Caenorhabditis elegans OX=6239 GN=sqv-8 PE=1 SV=1
7	AFDB:Q9Z137	0.684	0.707	1.031E-35	324	0.400	0.414	Q9Z137.pdb.gz	B3GA2_RAT Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=B3gat2 PE=1 SV=1
8	AFDB:Q9VTG7	0.655	0.464	3.517E-27	479	0.299	0.209	Q9VTG7.pdb.gz	B3G2P_DROME Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase P OS=Drosophila melanogaster OX=7227 GN=GlcAT-P PE=2 SV=1
9	AFDB:Q9VLA1	0.631	0.519	2.380E-25	409	0.313	0.257	Q9VLA1.pdb.gz	B3G2S_DROME Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase S OS=Drosophila melanogaster OX=7227 GN=GlcAT-S PE=1 SV=2
10	AFDB:Q9SXC4	0.587	0.502	2.735E-20	394	0.242	0.206	Q9SXC4.pdb.gz	IRX9H_ARATH Probable beta-1,4-xylosyltransferase IRX9H OS=Arabidopsis thaliana OX=3702 GN=IRX9H PE=2 SV=2
11	PDB:6fxrA	0.441	0.234	5.483E-6	700	0.101	0.049	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
12	PDB:7msnA	0.309	0.256	3.745E-5	417	0.101	0.082	7msnA.pdb.gz	Structural and mechanistic investigations of protein S-glycosyltransferases.
13	PDB:4hg6A	0.271	0.132	1.074E-4	747	0.101	0.046	4hg6A.pdb.gz	Crystallographic snapshot of cellulose synthesis and membrane translocation.
14	PDB:7x8kB	0.396	0.367	1.216E-4	367	0.099	0.090	7x8kB.pdb.gz	Crystal Structures of Arabidopsis thaliana GDP-D-Mannose Pyrophosphorylase VITAMIN C DEFECTIVE 1.
15	PDB:4y63A	0.375	0.433	1.464E-4	282	0.099	0.117	4y63A.pdb.gz	Design of Glycosyltransferase Inhibitors: Serine Analogues as Pyrophosphate Surrogates?
16	PDB:6h0bB	0.365	0.259	1.996E-4	521	0.131	0.084	6h0bB.pdb.gz	Structural and Mechanistic Insights into the Catalytic-Domain-Mediated Short-Range Glycosylation Preferences of GalNAc-T4.
17	PDB:7sckA	0.306	0.179	2.721E-4	642	0.066	0.034	7sckA.pdb.gz	Structural basis for heparan sulfate co-polymerase action by the EXT1-2 complex.
18	PDB:4fixA	0.360	0.210	3.487E-4	629	0.104	0.056	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
19	PDB:5vcmB	0.385	0.364	3.487E-4	358	0.101	0.095	5vcmB.pdb.gz	HumanN-acetylglucosaminyltransferase II substrate recognition uses a modular architecture that includes a convergent exosite.
20	PDB:7sckB	0.314	0.194	5.725E-4	598	0.087	0.048	7sckB.pdb.gz	Structural basis for heparan sulfate co-polymerase action by the EXT1-2 complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O94766	0.0	672	335	1.000	1.000	B3GA3_HUMAN Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3 OS=Homo sapiens OX=9606 GN=B3GAT3 PE=1 SV=2
2	P58158	0.0	626	335	0.958	0.958	B3GA3_MOUSE Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3 OS=Mus musculus OX=10090 GN=B3gat3 PE=1 SV=1
3	F8W289	4.69e-137	394	330	0.594	0.603	F8W289_DANRE Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase OS=Danio rerio OX=7955 GN=CHUNP6865 PE=3 SV=1
4	Q9P2W7	4.70e-85	261	334	0.445	0.446	B3GA1_HUMAN Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GAT1 PE=1 SV=2
5	O35789	9.83e-85	261	334	0.445	0.446	B3GA1_RAT Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=B3gat1 PE=1 SV=2
6	Q9CW73	9.83e-85	261	334	0.445	0.446	B3GA1_MOUSE Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 OS=Mus musculus OX=10090 GN=B3gat1 PE=2 SV=3
7	O97422	6.42e-80	248	306	0.403	0.441	B3GI_DROME Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase I OS=Drosophila melanogaster OX=7227 GN=GlcAT-I PE=2 SV=2
8	Q9Z137	1.07e-77	242	324	0.409	0.423	B3GA2_RAT Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=B3gat2 PE=1 SV=1
9	Q09363	3.21e-77	242	356	0.388	0.365	SQV8_CAEEL Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase sqv-8 OS=Caenorhabditis elegans OX=6239 GN=sqv-8 PE=1 SV=1
10	Q9NPZ5	1.66e-76	239	323	0.391	0.406	B3GA2_HUMAN Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GAT2 PE=1 SV=2
11	Q9VLA1	1.39e-50	175	409	0.301	0.247	B3G2S_DROME Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase S OS=Drosophila melanogaster OX=7227 GN=GlcAT-S PE=1 SV=2
12	Q9VTG7	2.13e-49	173	479	0.287	0.200	B3G2P_DROME Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase P OS=Drosophila melanogaster OX=7227 GN=GlcAT-P PE=2 SV=1
13	Q9SXC4	1.32e-26	110	394	0.242	0.206	IRX9H_ARATH Probable beta-1,4-xylosyltransferase IRX9H OS=Arabidopsis thaliana OX=3702 GN=IRX9H PE=2 SV=2
14	Q5QM25	1.75e-18	88.2	446	0.230	0.173	IRX9L_ORYSJ Probable beta-1,4-xylosyltransferase IRX9L OS=Oryza sativa subsp. japonica OX=39947 GN=IRX9L PE=2 SV=1
15	Q6AT32	1.36e-16	82.4	451	0.248	0.184	GT43E_ORYSJ Probable beta-1,4-xylosyltransferase GT43E OS=Oryza sativa subsp. japonica OX=39947 GN=GT43E PE=2 SV=1
16	Q7XTB2	1.23e-14	76.3	381	0.221	0.194	GT43H_ORYSJ Probable glucuronosyltransferase Os04g0103100 OS=Oryza sativa subsp. japonica OX=39947 GN=GT43H PE=2 SV=2
17	Q9FH90	6.47e-11	65.5	492	0.242	0.165	IX14H_ARATH Probable beta-1,4-xylosyltransferase IRX14H OS=Arabidopsis thaliana OX=3702 GN=IRX14H PE=2 SV=1
18	Q653F4	2.37e-10	63.9	524	0.230	0.147	IRX14_ORYSJ Probable beta-1,4-xylosyltransferase IRX14 OS=Oryza sativa subsp. japonica OX=39947 GN=IRX14 PE=2 SV=1
19	Q6V9S8	4.46e-10	62.4	368	0.230	0.209	Q6V9S8_GOSHI Glycosyltransferases OS=Gossypium hirsutum OX=3635 GN=GT43A1 PE=2 SV=1
20	Q8W4Z4	5.01e-10	62.0	336	0.179	0.179	Q8W4Z4_GOSHI Glycosyltransferases (Fragment) OS=Gossypium hirsutum OX=3635 GN=f14 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03360 Glyco_transf_43	7.2e-64	227.0	Glycosyltransferase family 43

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265471

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368496	0.988	Beta-1,3-galactosyltransferase 6
2	9606.ENSP00000363590	0.967	Chondroitin sulfate N-acetylgalactosaminyltransferase 2
3	9606.ENSP00000411816	0.956	Chondroitin sulfate N-acetylgalactosaminyltransferase 1
4	9606.ENSP00000292377	0.930	Glypican-2
5	9606.ENSP00000359864	0.930	Glypican-4
6	9606.ENSP00000363827	0.929	Basement membrane-specific heparan sulfate proteoglycan core protein
7	9606.ENSP00000265077	0.926	Versican core protein
8	9606.ENSP00000327336	0.926	Biglycan
9	9606.ENSP00000366246	0.926	Glypican-6
10	9606.ENSP00000366267	0.925	Glypican-5
11	9606.ENSP00000377836	0.925	Glypican-3
12	9606.ENSP00000264039	0.924	Glypican-1
13	9606.ENSP00000029410	0.921	Beta-1,4-galactosyltransferase 7
14	9606.ENSP00000052754	0.921	Decorin
15	9606.ENSP00000344468	0.921	Syndecan-3
16	9606.ENSP00000307046	0.920	Syndecan-2
17	9606.ENSP00000361818	0.914	Syndecan-4
18	9606.ENSP00000368678	0.913	Agrin
19	9606.ENSP00000370542	0.909	Syndecan-1
20	9606.ENSP00000331210	0.906	Brevican core protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0015020	1.000	glucuronosyltransferase activity
GO:0019888	0.996	protein phosphatase regulator activity
GO:0019211	0.996	phosphatase activator activity
GO:0072542	0.904	protein phosphatase activator activity
GO:0015018	0.385	galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1901137	0.995	carbohydrate derivative biosynthetic process
GO:1901566	0.995	organonitrogen compound biosynthetic process
GO:0009987	0.987	cellular process
GO:0044238	0.985	primary metabolic process
GO:0030203	0.984	glycosaminoglycan metabolic process
GO:0044237	0.983	cellular metabolic process
GO:0006023	0.983	aminoglycan biosynthetic process
GO:0006024	0.969	glycosaminoglycan biosynthetic process
GO:0044249	0.939	cellular biosynthetic process
GO:0019538	0.903	protein metabolic process
GO:0034645	0.899	cellular macromolecule biosynthetic process
GO:0009100	0.807	glycoprotein metabolic process
GO:0030166	0.795	proteoglycan biosynthetic process
GO:0044272	0.745	sulfur compound biosynthetic process
GO:0065007	0.499	biological regulation
GO:0050789	0.491	regulation of biological process
GO:0050794	0.436	regulation of cellular process
GO:0050650	0.414	chondroitin sulfate proteoglycan biosynthetic process
GO:0015012	0.324	heparan sulfate proteoglycan biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	1.000	Golgi membrane
GO:0005576	0.991	extracellular region
GO:0070062	0.980	extracellular exosome
GO:0043233	0.867	organelle lumen
GO:0005801	0.785	cis-Golgi network
GO:0070013	0.692	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21032	1.000	glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP
EC:2.4.1.17	1.000	glucuronosyltransferase.
RHEA:24168	0.385	3-O-(beta-D-galactosyl-(1->3)-beta-D-galactosyl-(1->4)-beta-D-xylosyl)-L-seryl-[protein] + UDP-alpha-D-glucuronate = 3-O-(beta-D-GlcA-(1->3)-beta-D-Gal-(1->3)-beta-D-Gal-(1->4)-beta-D-Xyl)-L-seryl-[protein] + H(+) + UDP
EC:2.4.1.135	0.385	galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase.

[back to server]