StarFunc result for job id O94776

User Input

>input (668 residues)
MAANMYRVGDYVYFENSSSNPYLVRRIEELNKTANGNVEAKVVCLFRRRDISSSLNSLAD
SNAREFEEESKQPGVSEQQRHQLKHRELFLSRQFESLPATHIRGKCSVTLLNETDILSQY
LEKEDCFFYSLVFDPVQKTLLADQGEIRVGCKYQAEIPDRLVEGESDNRNQQKMEMKVWD
PDNPLTDRQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQR
NGYDLAKAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSL
ASIVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIISVGSKPGMNGAG
FQKGLTCESCHTTQSAQWYAWGPPNMQCRLCASCWIYWKKYGGLKTPTQLEGATRGTTEP
HSRGHLSRPEAQSLSPYTTSANRAKLLAKNRQTFLLQTTKLTRLARRMCRDLLQPRRAAR
RPYAPINANAIKAECSIRLPKAAKTPLKIHPLVRLPLATIVKDLVAQAPLKPKTPRGTKT
PINRNQLSQNRGLGGIMVKRAYETMAGAGVPFSANGRPLASGIRSSSQPAAKRQKLNPAD
APNPVVFVATKDTRALRKALTHLEMRRAARRPNLPLKVKPTLIAVRPPVPLPAPSHPAST
NEPIVLED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R534	0.715	0.715	0.000	668	1.000	1.000	A0A024R534.pdb.gz
2	AFDB:F1QLG2	0.794	0.799	0.000	663	0.801	0.807	F1QLG2.pdb.gz	F1QLG2_DANRE Metastasis-associated 1 family, member 2 OS=Danio rerio OX=7955 GN=wu:fd61b05 PE=1 SV=2
3	AFDB:E7EY65	0.525	0.498	9.449E-82	709	0.615	0.580	E7EY65.pdb.gz	E7EY65_DANRE Metastasis-associated 1 family, member 3 OS=Danio rerio OX=7955 GN=fj99h01 PE=1 SV=1
4	AFDB:Q9BTC8	0.635	0.710	5.422E-80	594	0.573	0.645	Q9BTC8.pdb.gz	MTA3_HUMAN Metastasis-associated protein MTA3 OS=Homo sapiens OX=9606 GN=MTA3 PE=1 SV=2
5	AFDB:O61907	0.483	0.327	2.172E-43	1022	0.341	0.223	O61907.pdb.gz	O61907_CAEEL DIOX_N domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=lin-40 PE=1 SV=2
6	PDB:7aoaD	0.245	0.471	2.231E-42	343	0.389	0.758	7aoaD.pdb.gz	The topology of chromatin-binding domains in the NuRD deacetylase complex.
7	AFDB:E7F226	0.343	0.175	2.660E-32	1531	0.225	0.098	E7F226.pdb.gz
8	AFDB:M9PHT1	0.189	0.070	8.945E-9	2007	0.144	0.048	M9PHT1.pdb.gz	M9PHT1_DROME Grunge, isoform J OS=Drosophila melanogaster OX=7227 GN=Gug PE=1 SV=1
9	AFDB:Q05GC8	0.183	0.107	2.538E-7	1220	0.123	0.067	Q05GC8.pdb.gz	Q05GC8_HUMAN Breast cancer anti-estrogen resistance 2 OS=Homo sapiens OX=9606 GN=TRERF1 PE=1 SV=1
10	PDB:5z8lA	0.136	0.424	2.930E-6	204	0.040	0.132	5z8lA.pdb.gz	EBS is a bivalent histone reader that regulates floral phase transition in Arabidopsis.
11	AFDB:A0A0R4IFH7	0.157	0.122	1.900E-3	873	0.108	0.082	A0A0R4IFH7.pdb.gz
12	AFDB:Q54DS6	0.092	0.035	2.549E-3	2221	0.111	0.033	Q54DS6.pdb.gz	Q54DS6_DICDI SH3 domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=docA PE=3 SV=1
13	PDB:7vdvW	0.072	0.182	6.693E-2	248	0.034	0.093	7vdvW.pdb.gz	Structure of human chromatin-remodelling PBAF complex bound to a nucleosome.
14	PDB:4czzB	0.080	0.354	8.976E-2	133	0.046	0.233	4czzB.pdb.gz	Differential Properties of Transcriptional Complexes Formed by the Corest Family.
15	PDB:5l3cB	0.082	0.356	9.518E-2	134	0.046	0.231	5l3cB.pdb.gz	LSD1/KDM1A mutations associated to a newly described form of intellectual disability impair demethylase activity and binding to transcription factors.
16	PDB:6lthO	0.073	0.143	1.204E-1	325	0.030	0.062	6lthO.pdb.gz	Structure of nucleosome-bound human BAF complex.
17	PDB:6id0L	0.068	0.091	1.712E-1	475	0.072	0.101	6id0L.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
18	PDB:7vdvX	0.067	0.169	3.462E-1	252	0.046	0.123	7vdvX.pdb.gz	Structure of human chromatin-remodelling PBAF complex bound to a nucleosome.
19	PDB:2cjjA	0.070	0.641	4.923E-1	63	0.021	0.222	2cjjA.pdb.gz
20	PDB:7oydt	0.046	0.176	7.002E-1	126	0.012	0.063	7oydt.pdb.gz	A molecular network of conserved factors keeps ribosomes dormant in the egg.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2GV01	0.0	1368	668	0.981	0.981	B2GV01_RAT Metastasis-associated gene family, member 2 OS=Rattus norvegicus OX=10116 GN=Mta2 PE=1 SV=1
2	E7EQY4	0.0	750	514	0.543	0.706	E7EQY4_HUMAN Metastasis associated 1 family member 3 OS=Homo sapiens OX=9606 GN=MTA3 PE=1 SV=1
3	E7ESY4	0.0	796	703	0.627	0.596	E7ESY4_HUMAN Metastasis associated 1 OS=Homo sapiens OX=9606 GN=MTA1 PE=1 SV=1
4	E7EY65	0.0	770	709	0.626	0.590	E7EY65_DANRE Metastasis-associated 1 family, member 3 OS=Danio rerio OX=7955 GN=fj99h01 PE=1 SV=1
5	F1QLG2	0.0	1094	663	0.796	0.802	F1QLG2_DANRE Metastasis-associated 1 family, member 2 OS=Danio rerio OX=7955 GN=wu:fd61b05 PE=1 SV=2
6	F6RRE2	0.0	658	537	0.501	0.624	F6RRE2_HUMAN Metastasis associated 1 family member 3 OS=Homo sapiens OX=9606 GN=MTA3 PE=1 SV=1
7	F7F888	0.0	1364	670	0.981	0.978	F7F888_RAT Metastasis associated 1 family, member 2 OS=Rattus norvegicus OX=10116 GN=Mta2 PE=1 SV=1
8	O94776	0.0	1391	668	1.000	1.000	MTA2_HUMAN Metastasis-associated protein MTA2 OS=Homo sapiens OX=9606 GN=MTA2 PE=1 SV=1
9	Q13330	0.0	796	715	0.630	0.589	MTA1_HUMAN Metastasis-associated protein MTA1 OS=Homo sapiens OX=9606 GN=MTA1 PE=1 SV=2
10	Q62599	0.0	795	703	0.624	0.593	MTA1_RAT Metastasis-associated protein MTA1 OS=Rattus norvegicus OX=10116 GN=Mta1 PE=1 SV=1
11	Q7SXR7	0.0	1050	631	0.746	0.789	Q7SXR7_DANRE Metastasis associated 1 family, member 2 OS=Danio rerio OX=7955 GN=wu:fi29g02 PE=1 SV=1
12	Q7ZUE1	0.0	738	517	0.549	0.710	Q7ZUE1_DANRE Metastasis associated family, member 3 OS=Danio rerio OX=7955 GN=wu:fj99h01 PE=1 SV=1
13	Q8K4B0	0.0	795	715	0.629	0.587	MTA1_MOUSE Metastasis-associated protein MTA1 OS=Mus musculus OX=10090 GN=Mta1 PE=1 SV=1
14	Q924K8	0.0	755	591	0.579	0.655	MTA3_MOUSE Metastasis-associated protein MTA3 OS=Mus musculus OX=10090 GN=Mta3 PE=1 SV=1
15	Q9BTC8	0.0	768	594	0.575	0.646	MTA3_HUMAN Metastasis-associated protein MTA3 OS=Homo sapiens OX=9606 GN=MTA3 PE=1 SV=2
16	Q9R190	0.0	1376	668	0.985	0.985	MTA2_MOUSE Metastasis-associated protein MTA2 OS=Mus musculus OX=10090 GN=Mta2 PE=1 SV=1
17	Q9VNF7	0.0	550	844	0.437	0.346	Q9VNF7_DROME Metastasis associated 1-like, isoform B OS=Drosophila melanogaster OX=7227 GN=MTA1-like PE=1 SV=2
18	H0Y4T7	5.61e-180	523	511	0.419	0.548	H0Y4T7_HUMAN Metastasis associated 1 (Fragment) OS=Homo sapiens OX=9606 GN=MTA1 PE=1 SV=1
19	B7Z0T5	9.33e-179	532	853	0.422	0.331	B7Z0T5_DROME Metastasis associated 1-like, isoform C OS=Drosophila melanogaster OX=7227 GN=MTA1-like PE=1 SV=1
20	Q6AWS2	1.86e-178	531	857	0.422	0.329	Q6AWS2_DROME SD15071p OS=Drosophila melanogaster OX=7227 GN=MTA1-like PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01426 BAH	3e-25	99.8	BAH domain
2	PF01448 ELM2	1.4e-12	59.5	ELM2 domain
3	PF00320 GATA	3.9e-08	44.1	GATA zinc finger
4	PF17226 MTA_R1	3.9e-26	102.4	MTA R1 domain
5	PF00249 Myb_DNA-binding	0.23	23.0	Myb-like DNA-binding domain
6	PF15963 Myb_DNA-bind_7	40	15.4	Myb DNA-binding like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000278823

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000349508	0.999	Chromodomain-helicase-DNA-binding protein 4
2	9606.ENSP00000362592	0.999	Histone-binding protein RBBP4
3	9606.ENSP00000362649	0.999	Histone deacetylase 1
4	9606.ENSP00000369424	0.999	Histone-binding protein RBBP7
5	9606.ENSP00000430432	0.999	Histone deacetylase 2
6	9606.ENSP00000412302	0.998	Methyl-CpG-binding domain protein 3
7	9606.ENSP00000353463	0.997	Transcriptional repressor p66-alpha
8	9606.ENSP00000369716	0.997	Chromodomain-helicase-DNA-binding protein 3
9	9606.ENSP00000256429	0.996	Methyl-CpG-binding domain protein 2
10	9606.ENSP00000357644	0.995	Transcriptional repressor p66-beta
11	9606.ENSP00000269305	0.979	Cellular tumor antigen p53
12	9606.ENSP00000333633	0.970	Metastasis-associated protein MTA1
13	9606.ENSP00000262450	0.962	Chromodomain-helicase-DNA-binding protein 5
14	9606.ENSP00000434024	0.953	Histone H2AX
15	9606.ENSP00000383973	0.947	Metastasis-associated protein MTA3
16	9606.ENSP00000370800	0.946	methyl-CpG binding domain protein 3 like 2
17	9606.ENSP00000296417	0.935	Histone H2A.Z
18	9606.ENSP00000263253	0.934	Histone acetyltransferase p300
19	9606.ENSP00000383042	0.934	Lysine-specific histone demethylase 1A
20	9606.ENSP00000235090	0.933	Methylosome protein 50

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003676	0.927	nucleic acid binding
GO:0003677	0.916	DNA binding
GO:0008134	0.906	transcription factor binding
GO:0140110	0.895	transcription regulator activity
GO:0140297	0.881	DNA-binding transcription factor binding
GO:0043565	0.803	sequence-specific DNA binding
GO:0003690	0.788	double-stranded DNA binding
GO:0019899	0.785	enzyme binding
GO:1990837	0.776	sequence-specific double-stranded DNA binding
GO:0000976	0.745	transcription cis-regulatory region binding
GO:0061629	0.463	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0003712	0.416	transcription coregulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.991	regulation of biological process
GO:0009987	0.983	cellular process
GO:0050794	0.977	regulation of cellular process
GO:0008152	0.965	metabolic process
GO:0071704	0.954	organic substance metabolic process
GO:0044238	0.948	primary metabolic process
GO:0040012	0.917	regulation of locomotion
GO:0010762	0.907	regulation of fibroblast migration
GO:0006807	0.892	nitrogen compound metabolic process
GO:0060255	0.876	regulation of macromolecule metabolic process
GO:0080090	0.867	regulation of primary metabolic process
GO:0051171	0.867	regulation of nitrogen compound metabolic process
GO:0010468	0.859	regulation of gene expression
GO:0031323	0.858	regulation of cellular metabolic process
GO:0048519	0.853	negative regulation of biological process
GO:0071840	0.849	cellular component organization or biogenesis
GO:2001141	0.847	regulation of RNA biosynthetic process
GO:0006355	0.842	regulation of DNA-templated transcription
GO:0043170	0.841	macromolecule metabolic process
GO:0016043	0.821	cellular component organization
GO:0006325	0.808	chromatin organization
GO:1901564	0.799	organonitrogen compound metabolic process
GO:0036211	0.792	protein modification process
GO:0048523	0.790	negative regulation of cellular process
GO:0016570	0.777	histone modification
GO:0098732	0.760	macromolecule deacylation
GO:0048518	0.747	positive regulation of biological process
GO:0009892	0.717	negative regulation of metabolic process
GO:0010605	0.706	negative regulation of macromolecule metabolic process
GO:0051172	0.607	negative regulation of nitrogen compound metabolic process
GO:0031324	0.599	negative regulation of cellular metabolic process
GO:0048522	0.541	positive regulation of cellular process
GO:0045934	0.519	negative regulation of nucleobase-containing compound metabolic process
GO:0006338	0.480	chromatin remodeling
GO:0009890	0.467	negative regulation of biosynthetic process
GO:0010558	0.455	negative regulation of macromolecule biosynthetic process
GO:0031327	0.455	negative regulation of cellular biosynthetic process
GO:0051253	0.455	negative regulation of RNA metabolic process
GO:0044237	0.449	cellular metabolic process
GO:0045892	0.442	negative regulation of DNA-templated transcription
GO:0006357	0.417	regulation of transcription by RNA polymerase II
GO:0050896	0.399	response to stimulus
GO:0009893	0.396	positive regulation of metabolic process
GO:0010604	0.393	positive regulation of macromolecule metabolic process
GO:0051173	0.373	positive regulation of nitrogen compound metabolic process
GO:0006476	0.350	protein deacetylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.978	protein-containing complex
GO:0043232	0.977	intracellular non-membrane-bounded organelle
GO:0140513	0.897	nuclear protein-containing complex
GO:0000785	0.895	chromatin
GO:1902494	0.887	catalytic complex
GO:0005667	0.635	transcription regulator complex
GO:0005737	0.624	cytoplasm
GO:0016581	0.618	NuRD complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]