StarFunc result for job id O94777

User Input

>input (84 residues)
MATGTDQVVGLGLVAVSLIIFTYYTAWVILLPFIDSQHVIHKYFLPRAYAVAIPLAAGLL
LLLFVGLFISYVMLKTKRVTKKAQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O94777	1.000	1.000	8.568E-12	84	1.000	1.000	O94777.pdb.gz	DPM2_HUMAN Dolichol phosphate-mannose biosynthesis regulatory protein OS=Homo sapiens OX=9606 GN=DPM2 PE=1 SV=3
2	AFDB:Q545R7	0.914	0.914	1.416E-10	84	0.881	0.881	Q545R7.pdb.gz	Q545R7_MOUSE Dolichol phosphate-mannose biosynthesis regulatory protein OS=Mus musculus OX=10090 GN=Dpm2 PE=2 SV=1
3	AFDB:Q561S6	0.879	0.889	2.897E-7	83	0.571	0.578	Q561S6.pdb.gz	Q561S6_DANRE Dolichol phosphate-mannose biosynthesis regulatory protein OS=Danio rerio OX=7955 GN=wu:fa99c01 PE=2 SV=1
4	AFDB:Q9CA79	0.861	0.903	2.170E-6	80	0.512	0.537	Q9CA79.pdb.gz	DPM2_ARATH Dolichol-phosphate mannose synthase subunit 2 OS=Arabidopsis thaliana OX=3702 GN=DPMS2 PE=1 SV=1
5	AFDB:A0A1D8PPC1	0.886	0.876	5.933E-5	85	0.405	0.400	A0A1D8PPC1.pdb.gz	A0A1D8PPC1_CANAL Dolichol phosphate-mannose biosynthesis regulatory protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DPM2 PE=3 SV=1
6	AFDB:Q38ET7	0.512	0.308	1.402E-1	148	0.179	0.101	Q38ET7.pdb.gz	Q38ET7_TRYB2 Dolichol phosphate-mannose biosynthesis regulatory protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.4690 PE=3 SV=1
7	PDB:7xowR	0.230	0.091	4.409	276	0.143	0.043	7xowR.pdb.gz	Structural insights into human brain-gut peptide cholecystokinin receptors.
8	PDB:2y69M	0.273	0.483	4.737	43	0.048	0.093	2y69M.pdb.gz	A Combined Quantum Chemical and Crystallographic Study on the Oxidized Binuclear Center of Cytochrome C Oxidase.
9	AFDB:O15342	0.331	0.341	4.755	81	0.083	0.086	O15342.pdb.gz	VA0E1_HUMAN V-type proton ATPase subunit e 1 OS=Homo sapiens OX=9606 GN=ATP6V0E1 PE=1 SV=2
10	AFDB:P0AFS5	0.326	0.090	4.755	344	0.238	0.058	P0AFS5.pdb.gz	TQSA_ECOLI AI-2 transport protein TqsA OS=Escherichia coli (strain K12) OX=83333 GN=tqsA PE=1 SV=1
11	AFDB:Q9Y0V6	0.393	0.385	4.755	86	0.190	0.186	Q9Y0V6.pdb.gz	TIM10_CAEEL Mitochondrial import inner membrane translocase subunit Tim10 OS=Caenorhabditis elegans OX=6239 GN=tin-10 PE=3 SV=1
12	PDB:5tzyA	0.276	0.069	9.050	418	0.107	0.022	5tzyA.pdb.gz	Structural basis for the cooperative allosteric activation of the free fatty acid receptor GPR40.
13	AFDB:Q35309	0.269	0.279	9.084	80	0.190	0.200	Q35309.pdb.gz	Q35309_ORYSJ ORF80 OS=Oryza sativa subsp. japonica OX=39947 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O94777	1.49e-54	165	84	1.000	1.000	DPM2_HUMAN Dolichol phosphate-mannose biosynthesis regulatory protein OS=Homo sapiens OX=9606 GN=DPM2 PE=1 SV=3
2	Q545R7	1.31e-35	117	84	0.881	0.881	Q545R7_MOUSE Dolichol phosphate-mannose biosynthesis regulatory protein OS=Mus musculus OX=10090 GN=Dpm2 PE=2 SV=1
3	Q9Z325	3.45e-35	116	84	0.881	0.881	DPM2_RAT Dolichol phosphate-mannose biosynthesis regulatory protein OS=Rattus norvegicus OX=10116 GN=Dpm2 PE=1 SV=3
4	Q561S6	1.63e-30	104	83	0.583	0.590	Q561S6_DANRE Dolichol phosphate-mannose biosynthesis regulatory protein OS=Danio rerio OX=7955 GN=wu:fa99c01 PE=2 SV=1
5	Q9CA79	2.52e-22	84.0	80	0.548	0.575	DPM2_ARATH Dolichol-phosphate mannose synthase subunit 2 OS=Arabidopsis thaliana OX=3702 GN=DPMS2 PE=1 SV=1
6	A0A1D8PPC1	3.37e-17	70.9	85	0.345	0.341	A0A1D8PPC1_CANAL Dolichol phosphate-mannose biosynthesis regulatory protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DPM2 PE=3 SV=1
7	Q9USW6	4.19e-13	60.5	72	0.321	0.375	DPM2_SCHPO Dolichol phosphate-mannose biosynthesis regulatory protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dpm2 PE=3 SV=1
8	Q38ET7	8.77e-04	37.7	148	0.190	0.108	Q38ET7_TRYB2 Dolichol phosphate-mannose biosynthesis regulatory protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.4690 PE=3 SV=1
9	Q13145	0.32	30.8	260	0.155	0.050	BAMBI_HUMAN BMP and activin membrane-bound inhibitor homolog OS=Homo sapiens OX=9606 GN=BAMBI PE=1 SV=1
10	Q91XN4	0.32	30.8	260	0.155	0.050	BAMBI_RAT BMP and activin membrane-bound inhibitor homolog OS=Rattus norvegicus OX=10116 GN=Bambi PE=2 SV=1
11	Q9DFZ0	0.33	30.8	258	0.155	0.050	Q9DFZ0_DANRE BMP and activin membrane-bound inhibitor homolog OS=Danio rerio OX=7955 GN=bambi PE=2 SV=1
12	Q1A5L2	1.2	29.3	1466	0.167	0.010	Q1A5L2_DANRE Crb2 OS=Danio rerio OX=7955 GN=crb2 PE=1 SV=1
13	Q9Y719	3.3	28.1	2358	0.095	0.003	MOK13_SCHPO Cell wall alpha-1,3-glucan synthase mok13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mok13 PE=3 SV=2
14	P91643	4.4	27.7	880	0.179	0.017	P91643_DROME KEK1 OS=Drosophila melanogaster OX=7227 GN=kek1 PE=1 SV=1
15	Q9VK54	4.4	27.7	880	0.179	0.017	Q9VK54_DROME Kekkon 1, isoform B OS=Drosophila melanogaster OX=7227 GN=kek1 PE=4 SV=3
16	Q5A503	4.6	27.7	620	0.131	0.018	Q5A503_CANAL Oxidoreductase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=FET33 PE=3 SV=1
17	F4HY36	5.3	27.7	1805	0.190	0.009	F4HY36_ARATH Protein translocase subunit SecA OS=Arabidopsis thaliana OX=3702 GN=SECA2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19337 BAMBI_C	74	14.5	BMP and activin membrane-bound inhibitor homolog C-terminus
2	PF07297 DPM2	2.4e-28	109.5	Dolichol phosphate-mannose biosynthesis regulatory protein (DPM2)
3	PF08510 PIG-P	1.1	20.6	PIG-P

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000322181

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357384	0.999	Dolichol-phosphate mannosyltransferase subunit 3
2	9606.ENSP00000360644	0.999	Dolichol-phosphate mannosyltransferase subunit 1
3	9606.ENSP00000420037	0.992	Phosphatidylinositol N-acetylglucosaminyltransferase subunit P
4	9606.ENSP00000361667	0.991	Dolichol kinase
5	9606.ENSP00000356702	0.988	Phosphatidylinositol N-acetylglucosaminyltransferase subunit C
6	9606.ENSP00000216452	0.987	Phosphatidylinositol N-acetylglucosaminyltransferase subunit H
7	9606.ENSP00000432688	0.985	Phosphatidylinositol N-acetylglucosaminyltransferase subunit Y
8	9606.ENSP00000026218	0.982	Phosphatidylinositol N-acetylglucosaminyltransferase subunit Q
9	9606.ENSP00000361302	0.982	Protein O-mannosyl-transferase 1
10	9606.ENSP00000261534	0.981	Protein O-mannosyl-transferase 2
11	9606.ENSP00000369820	0.981	Phosphatidylinositol N-acetylglucosaminyltransferase subunit A
12	9606.ENSP00000225609	0.978	N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase
13	9606.ENSP00000363260	0.955	GPI mannosyltransferase 2
14	9606.ENSP00000386597	0.949	UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase
15	9606.ENSP00000361625	0.945	Dolichyldiphosphatase 1
16	9606.ENSP00000380793	0.945	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase
17	9606.ENSP00000262374	0.941	Chitobiosyldiphosphodolichol beta-mannosyltransferase
18	9606.ENSP00000357069	0.940	GPI mannosyltransferase 1
19	9606.ENSP00000239891	0.937	ALG5, dolichyl-phosphate beta-glucosyltransferase
20	9606.ENSP00000273968	0.931	Protein preY, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0098772	0.992	molecular function regulator activity
GO:0030234	0.984	enzyme regulator activity
GO:0003824	0.976	catalytic activity
GO:0016740	0.966	transferase activity
GO:0016757	0.959	glycosyltransferase activity
GO:0016758	0.766	hexosyltransferase activity
GO:0008047	0.440	enzyme activator activity
GO:0000030	0.330	mannosyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1901137	0.996	carbohydrate derivative biosynthetic process
GO:1901566	0.995	organonitrogen compound biosynthetic process
GO:0036211	0.995	protein modification process
GO:0034645	0.995	cellular macromolecule biosynthetic process
GO:0006506	0.992	GPI anchor biosynthetic process
GO:0006486	0.901	protein glycosylation
GO:0006720	0.827	isoprenoid metabolic process
GO:0006493	0.768	protein O-linked glycosylation
GO:0006066	0.760	alcohol metabolic process
GO:0065007	0.391	biological regulation
GO:0097502	0.378	mannosylation
GO:0019348	0.351	dolichol metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031501	1.000	mannosyltransferase complex
GO:0005783	1.000	endoplasmic reticulum
GO:0016020	0.982	membrane
GO:0031090	0.959	organelle membrane
GO:0005789	0.910	endoplasmic reticulum membrane
GO:0033185	0.742	dolichol-phosphate-mannose synthase complex
GO:0098796	0.702	membrane protein complex
GO:0140534	0.642	endoplasmic reticulum protein-containing complex
GO:0000506	0.391	glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.966	Transferases.
EC:2.4.-.-	0.959	Glycosyltransferases.
EC:2.4.1.-	0.766	Hexosyltransferases.

[back to server]