StarFunc result for job id O94782

User Input

>input (785 residues)
MPGVIPSESNGLSRGSPSKKNRLSLKFFQKKETKRALDFTDSQENEEKASEYRASEIDQV
VPAAQSSPINCEKRENLLPFVGLNNLGNTCYLNSILQVLYFCPGFKSGVKHLFNIISRKK
EALKDEANQKDKGNCKEDSLASYELICSLQSLIISVEQLQASFLLNPEKYTDELATQPRR
LLNTLRELNPMYEGYLQHDAQEVLQCILGNIQETCQLLKKEEVKNVAELPTKVEEIPHPK
EEMNGINSIEMDSMRHSEDFKEKLPKGNGKRKSDTEFGNMKKKVKLSKEHQSLEENQRQT
RSKRKATSDTLESPPKIIPKYISENESPRPSQKKSRVKINWLKSATKQPSILSKFCSLGK
ITTNQGVKGQSKENECDPEEDLGKCESDNTTNGCGLESPGNTVTPVNVNEVKPINKGEEQ
IGFELVEKLFQGQLVLRTRCLECESLTERREDFQDISVPVQEDELSKVEESSEISPEPKT
EMKTLRWAISQFASVERIVGEDKYFCENCHHYTEAERSLLFDKMPEVITIHLKCFAASGL
EFDCYGGGLSKINTPLLTPLKLSLEEWSTKPTNDSYGLFAVVMHSGITISSGHYTASVKV
TDLNSLELDKGNFVVDQMCEIGKPEPLNEEEARGVVENYNDEEVSIRVGGNTQPSKVLNK
KNVEAIGLLGGQKSKADYELYNKASNPDKVASTAFAENRNSETSDTTGTHESDRNKESSD
QTGINISGFENKISYVVQSLKEYEGKWLLFDDSEVKVTEEKDFLNSLSPSTSPTSTPYLL
FYKKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O94782	1.000	1.000	0.000	785	1.000	1.000	O94782.pdb.gz	UBP1_HUMAN Ubiquitin carboxyl-terminal hydrolase 1 OS=Homo sapiens OX=9606 GN=USP1 PE=1 SV=1
2	AFDB:Q8BJQ2	0.724	0.725	0.000	784	0.880	0.881	Q8BJQ2.pdb.gz	UBP1_MOUSE Ubiquitin carboxyl-terminal hydrolase 1 OS=Mus musculus OX=10090 GN=Usp1 PE=1 SV=1
3	AFDB:Q5ZJE0	0.577	0.571	7.439E-96	794	0.738	0.729	Q5ZJE0.pdb.gz	Q5ZJE0_CHICK Ubiquitin carboxyl-terminal hydrolase OS=Gallus gallus OX=9031 GN=RCJMB04_19b7 PE=2 SV=1
4	PDB:7ay1D	0.424	0.961	3.175E-45	341	0.431	0.991	7ay1D.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
5	PDB:8a9kD	0.347	0.932	5.101E-37	285	0.355	0.979	8a9kD.pdb.gz	Cryo-EM reveals a mechanism of USP1 inhibition through a cryptic binding site.
6	PDB:5cvnB	0.351	0.837	1.480E-22	321	0.143	0.349	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
7	PDB:5k16B	0.331	0.750	2.422E-20	328	0.140	0.335	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
8	AFDB:Q6PAW2	0.294	0.259	1.502E-17	901	0.177	0.154	Q6PAW2.pdb.gz	UBP16_XENLA Ubiquitin carboxyl-terminal hydrolase 16 OS=Xenopus laevis OX=8355 GN=usp16 PE=2 SV=1
9	PDB:3mhsA	0.318	0.530	1.917E-16	455	0.120	0.207	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
10	PDB:7yxxA	0.301	0.138	7.027E-15	1754	0.090	0.040	7yxxA.pdb.gz
11	PDB:5gjqx	0.328	0.698	3.316E-14	355	0.116	0.256	5gjqx.pdb.gz	An atomic structure of the human 26S proteasome.
12	PDB:7w3ax	0.325	0.506	1.565E-13	494	0.117	0.186	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.
13	PDB:5k1bA	0.242	0.672	2.306E-13	264	0.115	0.341	5k1bA.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
14	PDB:4fjcE	0.207	0.361	6.608E-13	434	0.062	0.113	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
15	AFDB:P0DPF3	0.048	0.037	3.387E-2	1111	0.127	0.090	P0DPF3.pdb.gz	NBPF9_HUMAN Neuroblastoma breakpoint family member 9 OS=Homo sapiens OX=9606 GN=NBPF9 PE=2 SV=1
16	AFDB:O74653	0.057	0.053	6.230E-2	871	0.149	0.134	O74653.pdb.gz	POB1_SCHPO Protein pob1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pob1 PE=1 SV=1
17	AFDB:Q5YL88	0.049	0.035	8.687E-2	1205	0.140	0.091	Q5YL88.pdb.gz	Q5YL88_MOUSE Histone-lysine N-methyltransferase, H3 lysine-79 specific (Fragment) OS=Mus musculus OX=10090 GN=Dot1l PE=2 SV=1
18	AFDB:Q8WXD9	0.052	0.039	1.785E-1	1431	0.085	0.047	Q8WXD9.pdb.gz	CSKI1_HUMAN Caskin-1 OS=Homo sapiens OX=9606 GN=CASKIN1 PE=1 SV=1
19	AFDB:Q22002	0.048	0.061	1.887E-1	582	0.071	0.096	Q22002.pdb.gz	MAB10_CAEEL NAB transcription cofactor mab-10 OS=Caenorhabditis elegans OX=6239 GN=mab-10 PE=1 SV=2
20	AFDB:D3ZDV9	0.050	0.049	2.781E-1	793	0.099	0.098	D3ZDV9.pdb.gz	D3ZDV9_RAT NIMA-related kinase 4 OS=Rattus norvegicus OX=10116 GN=Nek4 PE=4 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O94782	0.0	1606	785	1.000	1.000	UBP1_HUMAN Ubiquitin carboxyl-terminal hydrolase 1 OS=Homo sapiens OX=9606 GN=USP1 PE=1 SV=1
2	Q5ZJE0	0.0	1100	794	0.735	0.727	Q5ZJE0_CHICK Ubiquitin carboxyl-terminal hydrolase OS=Gallus gallus OX=9031 GN=RCJMB04_19b7 PE=2 SV=1
3	Q8BJQ2	0.0	1380	784	0.885	0.886	UBP1_MOUSE Ubiquitin carboxyl-terminal hydrolase 1 OS=Mus musculus OX=10090 GN=Usp1 PE=1 SV=1
4	Q9D9M2	1.73e-17	87.4	370	0.074	0.157	UBP12_MOUSE Ubiquitin carboxyl-terminal hydrolase 12 OS=Mus musculus OX=10090 GN=Usp12 PE=2 SV=2
5	O75317	2.34e-17	87.0	370	0.074	0.157	UBP12_HUMAN Ubiquitin carboxyl-terminal hydrolase 12 OS=Homo sapiens OX=9606 GN=USP12 PE=1 SV=2
6	P62068	3.80e-17	86.3	366	0.078	0.167	UBP46_HUMAN Ubiquitin carboxyl-terminal hydrolase 46 OS=Homo sapiens OX=9606 GN=USP46 PE=1 SV=1
7	P62069	3.80e-17	86.3	366	0.078	0.167	UBP46_MOUSE Ubiquitin carboxyl-terminal hydrolase 46 OS=Mus musculus OX=10090 GN=Usp46 PE=1 SV=1
8	Q54G37	7.01e-17	86.7	475	0.065	0.107	Q54G37_DICDI Ubiquitin carboxyl-terminal hydrolase OS=Dictyostelium discoideum OX=44689 GN=usp12 PE=3 SV=2
9	F1M625	7.42e-17	85.5	366	0.070	0.150	UBP46_RAT Ubiquitin carboxyl-terminal hydrolase 46 OS=Rattus norvegicus OX=10116 GN=Usp46 PE=1 SV=2
10	P34547	5.78e-16	83.2	426	0.066	0.122	UBP46_CAEEL Ubiquitin carboxyl-terminal hydrolase 46 OS=Caenorhabditis elegans OX=6239 GN=usp-46 PE=1 SV=3
11	Q9VCT9	1.60e-14	79.0	424	0.065	0.120	Q9VCT9_DROME RE52890p OS=Drosophila melanogaster OX=7227 GN=Usp12-46 PE=2 SV=1
12	Q7ZUM8	1.04e-13	77.4	695	0.083	0.094	UBP44_DANRE Ubiquitin carboxyl-terminal hydrolase 44 OS=Danio rerio OX=7955 GN=usp44 PE=2 SV=1
13	P39967	1.54e-13	77.0	754	0.059	0.061	UBP9_YEAST Ubiquitin carboxyl-terminal hydrolase 9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBP9 PE=1 SV=1
14	P38187	2.68e-13	76.3	747	0.064	0.067	UBP13_YEAST Ubiquitin carboxyl-terminal hydrolase 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBP13 PE=1 SV=3
15	Q96V54	5.91e-13	75.1	766	0.073	0.074	CREB_EMENI Ubiquitin carboxyl-terminal hydrolase creB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=creB PE=1 SV=1
16	A0A1D8PFU3	4.48e-12	72.0	811	0.066	0.064	A0A1D8PFU3_CANAL Ubiquitin carboxyl-terminal hydrolase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DOA4 PE=3 SV=1
17	Q70EL2	1.54e-11	70.5	814	0.057	0.055	UBP45_HUMAN Ubiquitin carboxyl-terminal hydrolase 45 OS=Homo sapiens OX=9606 GN=USP45 PE=1 SV=3
18	E9PEW0	2.49e-11	69.3	548	0.056	0.080	E9PEW0_HUMAN Ubiquitin carboxyl-terminal hydrolase OS=Homo sapiens OX=9606 GN=USP36 PE=1 SV=2
19	B1AQJ2	2.69e-11	69.7	1098	0.057	0.041	UBP36_MOUSE Ubiquitin carboxyl-terminal hydrolase 36 OS=Mus musculus OX=10090 GN=Usp36 PE=1 SV=1
20	E7F4C0	2.89e-11	69.7	1104	0.057	0.041	E7F4C0_DANRE Ubiquitin carboxyl-terminal hydrolase 36 OS=Danio rerio OX=7955 GN=usp37 PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00443 UCH	9.7e-40	148.4	Ubiquitin carboxyl-terminal hydrolase
2	PF13423 UCH_1	6.3e-09	47.5	Ubiquitin carboxyl-terminal hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000343526

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307491	0.999	WD repeat-containing protein 48
2	9606.ENSP00000287647	0.998	Fanconi anemia group D2 protein
3	9606.ENSP00000310842	0.995	Fanconi anemia group I protein
4	9606.ENSP00000313171	0.986	ATPase family AAA domain-containing protein 5
5	9606.ENSP00000385021	0.983	E3 ubiquitin-protein ligase FANCL
6	9606.ENSP00000267430	0.975	Fanconi anemia group M protein
7	9606.ENSP00000333283	0.973	Fanconi anemia core complex-associated protein 100
8	9606.ENSP00000289081	0.971	Fanconi anemia group C protein
9	9606.ENSP00000373952	0.971	Fanconi anemia group A protein
10	9606.ENSP00000381378	0.969	Fanconi anemia group B protein
11	9606.ENSP00000229769	0.966	Fanconi anemia group E protein
12	9606.ENSP00000330875	0.966	Fanconi anemia group F protein
13	9606.ENSP00000367910	0.962	Fanconi anemia group G protein
14	9606.ENSP00000466121	0.962	Fanconi anemia core complex-associated protein 24
15	9606.ENSP00000294008	0.957	Structure-specific endonuclease subunit SLX4
16	9606.ENSP00000368458	0.952	Proliferating cell nuclear antigen
17	9606.ENSP00000355185	0.949	DNA cross-link repair 1A protein
18	9606.ENSP00000441543	0.948	Polyubiquitin-C
19	9606.ENSP00000376168	0.944	Centromere protein X
20	9606.ENSP00000354497	0.943	Fanconi-associated nuclease 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004197	1.000	cysteine-type endopeptidase activity
GO:0004843	1.000	cysteine-type deubiquitinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.992	primary metabolic process
GO:0006807	0.989	nitrogen compound metabolic process
GO:0050896	0.988	response to stimulus
GO:0043170	0.985	macromolecule metabolic process
GO:0070647	0.970	protein modification by small protein conjugation or removal
GO:0050794	0.939	regulation of cellular process
GO:0009987	0.915	cellular process
GO:0006508	0.911	proteolysis
GO:0051171	0.888	regulation of nitrogen compound metabolic process
GO:0048518	0.885	positive regulation of biological process
GO:0080090	0.877	regulation of primary metabolic process
GO:0044237	0.863	cellular metabolic process
GO:0060255	0.863	regulation of macromolecule metabolic process
GO:0051052	0.850	regulation of DNA metabolic process
GO:0048522	0.819	positive regulation of cellular process
GO:0080135	0.818	regulation of cellular response to stress
GO:0051716	0.766	cellular response to stimulus
GO:0010604	0.766	positive regulation of macromolecule metabolic process
GO:0051173	0.765	positive regulation of nitrogen compound metabolic process
GO:2001020	0.763	regulation of response to DNA damage stimulus
GO:0070646	0.748	protein modification by small protein removal
GO:0051054	0.736	positive regulation of DNA metabolic process
GO:0006282	0.669	regulation of DNA repair
GO:0010556	0.638	regulation of macromolecule biosynthetic process
GO:0031326	0.638	regulation of cellular biosynthetic process
GO:0048584	0.637	positive regulation of response to stimulus
GO:0006950	0.635	response to stress
GO:0044260	0.629	cellular macromolecule metabolic process
GO:0045739	0.607	positive regulation of DNA repair
GO:0034641	0.545	cellular nitrogen compound metabolic process
GO:2000278	0.527	regulation of DNA biosynthetic process
GO:0033554	0.508	cellular response to stress
GO:0016579	0.501	protein deubiquitination
GO:0006974	0.449	cellular response to DNA damage stimulus
GO:0046483	0.441	heterocycle metabolic process
GO:1901360	0.440	organic cyclic compound metabolic process
GO:0006725	0.440	cellular aromatic compound metabolic process
GO:0006281	0.427	DNA repair
GO:2000573	0.351	positive regulation of DNA biosynthetic process
GO:0009314	0.317	response to radiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.761	cytosol
GO:0043232	0.699	intracellular non-membrane-bounded organelle
GO:0032991	0.457	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.22.-	1.000	Cysteine endopeptidases.
EC:3.4.19.12	1.000	ubiquitinyl hydrolase 1.

[back to server]