StarFunc result for job id O94804

User Input

>input (968 residues)
MAFANFRRILRLSTFEKRKSREYEHVRRDLDPNEVWEIVGELGDGAFGKVYKAKNKETGA
LAAAKVIETKSEEELEDYIVEIEILATCDHPYIVKLLGAYYHDGKLWIMIEFCPGGAVDA
IMLELDRGLTEPQIQVVCRQMLEALNFLHSKRIIHRDLKAGNVLMTLEGDIRLADFGVSA
KNLKTLQKRDSFIGTPYWMAPEVVMCETMKDTPYDYKADIWSLGITLIEMAQIEPPHHEL
NPMRVLLKIAKSDPPTLLTPSKWSVEFRDFLKIALDKNPETRPSAAQLLEHPFVSSITSN
KALRELVAEAKAEVMEEIEDGRDEGEEEDAVDAASTLENHTQNSSEVSPPSLNADKPLEE
SPSTPLAPSQSQDSVNEPCSQPSGDRSLQTTSPPVVAPGNENGLAVPVPLRKSRPVSMDA
RIQVAQEKQVAEQGGDLSPAANRSQKASQSRPNSSALETLGGEKLANGSLEPPAQAAPGP
SKRDSDCSSLCTSESMDYGTNLSTDLSLNKEMGSLSIKDPKLYKKTLKRTRKFVVDGVEV
SITTSKIISEDEKKDEEMRFLRRQELRELRLLQKEEHRNQTQLSNKHELQLEQMHKRFEQ
EINAKKKFFDTELENLERQQKQQVEKMEQDHAVRRREEARRIRLEQDRDYTRFQEQLKLM
KKEVKNEVEKLPRQQRKESMKQKMEEHTQKKQLLDRDFVAKQKEDLELAMKRLTTDNRRE
ICDKERECLMKKQELLRDREAALWEMEEHQLQERHQLVKQQLKDQYFLQRHELLRKHEKE
REQMQRYNQRMIEQLKVRQQQEKARLPKIQRSEGKTRMAMYKKSLHINGGGSAAEQREKI
KQFSQQEEKRQKSERLQQQQKHENQMRDMLAQCESNMSELQQLQNEKCHLLVEHETQKLK
ALDESHNQNLKEWRDKLRPRKKALEEDLNQKKREQEMFFKLSEEAECPNPSTPSKAAKFF
PYSSADAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B7ZR30	0.760	0.774	0.000	950	0.651	0.663	B7ZR30.pdb.gz	STK10_XENLA Serine/threonine-protein kinase 10-A OS=Xenopus laevis OX=8355 GN=stk10-a PE=1 SV=1
2	AFDB:F1NBT0	0.757	0.757	0.000	969	0.741	0.740	F1NBT0.pdb.gz	STK10_CHICK Serine/threonine-protein kinase 10 OS=Gallus gallus OX=9031 GN=STK10 PE=3 SV=2
3	AFDB:O55098	0.800	0.802	0.000	966	0.881	0.883	O55098.pdb.gz	STK10_MOUSE Serine/threonine-protein kinase 10 OS=Mus musculus OX=10090 GN=Stk10 PE=1 SV=2
4	AFDB:O94804	1.000	1.000	0.000	968	1.000	1.000	O94804.pdb.gz	STK10_HUMAN Serine/threonine-protein kinase 10 OS=Homo sapiens OX=9606 GN=STK10 PE=1 SV=1
5	AFDB:O54988	0.711	0.566	1.008E-90	1233	0.590	0.463	O54988.pdb.gz	SLK_MOUSE STE20-like serine/threonine-protein kinase OS=Mus musculus OX=10090 GN=Slk PE=1 SV=2
6	AFDB:Q9H2G2	0.722	0.571	6.797E-90	1235	0.576	0.452	Q9H2G2.pdb.gz	SLK_HUMAN STE20-like serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=SLK PE=1 SV=1
7	AFDB:O08815	0.677	0.549	1.725E-85	1206	0.566	0.454	O08815.pdb.gz	SLK_RAT STE20-like serine/threonine-protein kinase OS=Rattus norvegicus OX=10116 GN=Slk PE=1 SV=1
8	AFDB:Q9W179	0.693	0.406	2.574E-69	1703	0.429	0.244	Q9W179.pdb.gz	Q9W179_DROME Sterile20-like kinase, isoform B OS=Drosophila melanogaster OX=7227 GN=Slik PE=1 SV=2
9	AFDB:Q0KHQ5	0.304	0.287	1.286E-44	1039	0.231	0.216	Q0KHQ5.pdb.gz	TAO_DROME Serine/threonine-protein kinase Tao OS=Drosophila melanogaster OX=7227 GN=Tao PE=1 SV=1
10	AFDB:P46549	0.399	0.394	5.266E-39	982	0.219	0.216	P46549.pdb.gz	SULU_CAEEL Serine/threonine-protein kinase SULU OS=Caenorhabditis elegans OX=6239 GN=kin-18 PE=1 SV=1
11	PDB:3eqdA	0.256	0.748	1.554E-21	315	0.098	0.302	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
12	PDB:4eomC	0.252	0.838	9.923E-21	276	0.094	0.330	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
13	PDB:3c4wB	0.258	0.468	5.999E-20	519	0.093	0.173	3c4wB.pdb.gz	Structures of rhodopsin kinase in different ligand states reveal key elements involved in G protein-coupled receptor kinase activation.
14	PDB:6byrA	0.264	0.603	7.879E-20	405	0.086	0.205	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
15	PDB:5x3fB	0.259	0.666	3.080E-19	349	0.079	0.218	5x3fB.pdb.gz
16	PDB:2yaaA	0.254	0.780	9.164E-19	300	0.077	0.250	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
17	PDB:4krcA	0.252	0.780	1.079E-18	297	0.086	0.279	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
18	PDB:4zhxA	0.249	0.565	1.418E-18	409	0.068	0.161	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
19	PDB:5u6yA	0.249	0.506	2.316E-18	459	0.081	0.170	5u6yA.pdb.gz
20	PDB:4mk0A	0.257	0.386	2.582E-18	631	0.072	0.111	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B7ZR30	0.0	1231	950	0.658	0.671	STK10_XENLA Serine/threonine-protein kinase 10-A OS=Xenopus laevis OX=8355 GN=stk10-a PE=1 SV=1
2	F1NBT0	0.0	1465	969	0.749	0.748	STK10_CHICK Serine/threonine-protein kinase 10 OS=Gallus gallus OX=9031 GN=STK10 PE=3 SV=2
3	O54988	0.0	562	1233	0.298	0.234	SLK_MOUSE STE20-like serine/threonine-protein kinase OS=Mus musculus OX=10090 GN=Slk PE=1 SV=2
4	O55098	0.0	1731	966	0.885	0.887	STK10_MOUSE Serine/threonine-protein kinase 10 OS=Mus musculus OX=10090 GN=Stk10 PE=1 SV=2
5	O94804	0.0	1993	968	1.000	1.000	STK10_HUMAN Serine/threonine-protein kinase 10 OS=Homo sapiens OX=9606 GN=STK10 PE=1 SV=1
6	Q9H2G2	0.0	578	1235	0.312	0.245	SLK_HUMAN STE20-like serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=SLK PE=1 SV=1
7	O08815	1.23e-168	526	1206	0.240	0.192	SLK_RAT STE20-like serine/threonine-protein kinase OS=Rattus norvegicus OX=10116 GN=Slk PE=1 SV=1
8	Q8MLP1	2.29e-123	408	1300	0.186	0.138	Q8MLP1_DROME Sterile20-like kinase, isoform A OS=Drosophila melanogaster OX=7227 GN=Slik PE=1 SV=1
9	Q7YZB2	4.16e-123	408	1342	0.186	0.134	Q7YZB2_DROME Polo kinase kinase 1 OS=Drosophila melanogaster OX=7227 GN=Slik PE=2 SV=1
10	Q59E61	4.42e-123	408	1342	0.186	0.134	Q59E61_DROME FI24227p1 OS=Drosophila melanogaster OX=7227 GN=Slik PE=1 SV=1
11	A4UZU8	5.26e-123	408	1365	0.186	0.132	A4UZU8_DROME Sterile20-like kinase, isoform G OS=Drosophila melanogaster OX=7227 GN=Slik PE=1 SV=1
12	B7YZQ1	1.32e-121	408	1635	0.186	0.110	B7YZQ1_DROME Sterile20-like kinase, isoform F OS=Drosophila melanogaster OX=7227 GN=Slik PE=1 SV=1
13	Q9W179	3.69e-121	407	1703	0.186	0.106	Q9W179_DROME Sterile20-like kinase, isoform B OS=Drosophila melanogaster OX=7227 GN=Slik PE=1 SV=2
14	Q9JI11	2.55e-80	271	487	0.130	0.259	STK4_MOUSE Serine/threonine-protein kinase 4 OS=Mus musculus OX=10090 GN=Stk4 PE=1 SV=1
15	Q7ZUQ3	2.84e-80	271	492	0.129	0.254	STK3_DANRE Serine/threonine-protein kinase 3 OS=Danio rerio OX=7955 GN=stk3 PE=2 SV=1
16	Q9JI10	3.78e-80	271	497	0.128	0.249	STK3_MOUSE Serine/threonine-protein kinase 3 OS=Mus musculus OX=10090 GN=Stk3 PE=1 SV=1
17	Q13043	4.08e-80	271	487	0.130	0.259	STK4_HUMAN Serine/threonine-protein kinase 4 OS=Homo sapiens OX=9606 GN=STK4 PE=1 SV=2
18	D4A648	5.41e-80	270	488	0.130	0.258	D4A648_RAT non-specific serine/threonine protein kinase OS=Rattus norvegicus OX=10116 GN=Stk4 PE=1 SV=2
19	Q13188	1.13e-79	270	491	0.127	0.251	STK3_HUMAN Serine/threonine-protein kinase 3 OS=Homo sapiens OX=9606 GN=STK3 PE=1 SV=2
20	O61125	3.82e-77	262	461	0.134	0.282	STK4_DICDI Serine/threonine-protein kinase 4 homolog A OS=Dictyostelium discoideum OX=44689 GN=krsA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00069 Pkinase	2.6e-60	215.6	Protein kinase domain
2	PF12474 PKK	4.7e-63	222.9	Polo kinase kinase
3	PF07714 PK_Tyr_Ser-Thr	9.8e-44	161.1	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000176763

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000249299	0.726	U6 snRNA-associated Sm-like protein LSm8
2	9606.ENSP00000410758	0.726	U6 snRNA-associated Sm-like protein LSm5
3	9606.ENSP00000356042	0.712	Ezrin
4	9606.ENSP00000353408	0.688	Moesin
5	9606.ENSP00000384136	0.679	Radixin
6	9606.ENSP00000466248	0.641	Inactive serine/threonine-protein kinase PLK5
7	9606.ENSP00000311760	0.582	Belongs to the TTC9 family
8	9606.ENSP00000362773	0.579	Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4
9	9606.ENSP00000405635	0.566	CTD nuclear envelope phosphatase 1 regulatory subunit 1
10	9606.ENSP00000362803	0.539	Peptidyl-prolyl cis-trans isomerase-like 1
11	9606.ENSP00000313034	0.523	F-box/WD repeat-containing protein 5
12	9606.ENSP00000259895	0.517	General transcription factor IIH subunit 4
13	9606.ENSP00000346634	0.508	Thyroid hormone receptor-associated protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0042802	0.405	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0071704	0.940	organic substance metabolic process
GO:0044237	0.934	cellular metabolic process
GO:0030334	0.932	regulation of cell migration
GO:0044238	0.928	primary metabolic process
GO:0002685	0.919	regulation of leukocyte migration
GO:0071675	0.893	regulation of mononuclear cell migration
GO:0006807	0.876	nitrogen compound metabolic process
GO:0043170	0.871	macromolecule metabolic process
GO:2000401	0.839	regulation of lymphocyte migration
GO:1901564	0.680	organonitrogen compound metabolic process
GO:0019538	0.656	protein metabolic process
GO:0036211	0.653	protein modification process
GO:0006468	0.442	protein phosphorylation
GO:0048518	0.382	positive regulation of biological process
GO:0048522	0.337	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.998	membrane-bounded organelle
GO:0005737	0.998	cytoplasm
GO:0016020	0.996	membrane
GO:0043231	0.990	intracellular membrane-bounded organelle
GO:0005829	0.984	cytosol
GO:0005886	0.963	plasma membrane
GO:0070013	0.929	intracellular organelle lumen
GO:0005576	0.917	extracellular region
GO:0031982	0.912	vesicle
GO:0005634	0.874	nucleus
GO:0070062	0.834	extracellular exosome
GO:0012505	0.725	endomembrane system
GO:0031981	0.651	nuclear lumen
GO:0032991	0.567	protein-containing complex
GO:0031090	0.414	organelle membrane
GO:0031410	0.376	cytoplasmic vesicle
GO:0043232	0.308	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]