StarFunc result for job id O94808

User Input

>input (682 residues)
MCGIFAYMNYRVPRTRKEIFETLIKGLQRLEYRGYDSAGVAIDGNNHEVKERHIQLVKKR
GKVKALDEELYKQDSMDLKVEFETHFGIAHTRWATHGVPSAVNSHPQRSDKGNEFVVIHN
GIITNYKDLRKFLESKGYEFESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQLEG
AFALVFKSVHYPGEAVATRRGSPLLIGVRSKYKLSTEQIPILYRTCTLENVKNICKTRMK
RLDSSACLHAVGDKAVEFFFASDASAIIEHTNRVIFLEDDDIAAVADGKLSIHRVKRSAS
DDPSRAIQTLQMELQQIMKGNFSAFMQKEIFEQPESVFNTMRGRVNFETNTVLLGGLKDH
LKEIRRCRRLIVIGCGTSYHAAVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFF
ISQSGETADTLLALRYCKDRGALTVGVTNTVGSSISRETDCGVHINAGPEIGVASTKAYT
SQFISLVMFGLMMSEDRISLQNRRQEIIRGLRSLPELIKEVLSLEEKIHDLALELYTQRS
LLVMGRGYNYATCLEGALKIKEITYMHSEGILAGELKHGPLALIDKQMPVIMVIMKDPCF
AKCQNALQQVTARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFH
LAVLRGYDVDFPRNLAKSVTVE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O94808	1.000	1.000	0.000	682	1.000	1.000	O94808.pdb.gz	GFPT2_HUMAN Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 OS=Homo sapiens OX=9606 GN=GFPT2 PE=1 SV=3
2	AFDB:Q06210	0.981	0.957	0.000	699	0.790	0.771	Q06210.pdb.gz	GFPT1_HUMAN Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1 PE=1 SV=3
3	AFDB:Q3S344	0.983	0.983	0.000	682	0.790	0.790	Q3S344.pdb.gz	Q3S344_DANRE glutamine--fructose-6-phosphate transaminase (isomerizing) OS=Danio rerio OX=7955 GN=hmn PE=1 SV=1
4	AFDB:Q7PLC7	0.965	0.949	0.000	694	0.650	0.638	Q7PLC7.pdb.gz	Q7PLC7_DROME glutamine--fructose-6-phosphate transaminase (isomerizing) OS=Drosophila melanogaster OX=7227 GN=Gfat1 PE=1 SV=2
5	AFDB:Q9VAW3	0.981	0.979	0.000	683	0.664	0.663	Q9VAW3.pdb.gz	Q9VAW3_DROME glutamine--fructose-6-phosphate transaminase (isomerizing) OS=Drosophila melanogaster OX=7227 GN=Gfat2 PE=1 SV=1
6	AFDB:Q19130	0.964	0.907	1.696E-98	725	0.606	0.570	Q19130.pdb.gz	Q19130_CAEEL glutamine--fructose-6-phosphate transaminase (isomerizing) OS=Caenorhabditis elegans OX=6239 GN=gfat-1 PE=1 SV=1
7	AFDB:P14742	0.956	0.910	9.872E-97	717	0.579	0.551	P14742.pdb.gz	GFA1_YEAST Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GFA1 PE=1 SV=4
8	AFDB:P53704	0.956	0.915	3.959E-96	713	0.576	0.551	P53704.pdb.gz	GFA1_CANAL Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GFA1 PE=1 SV=3
9	AFDB:Q09740	0.963	0.944	8.235E-95	696	0.545	0.534	Q09740.pdb.gz	GFA1_SCHPO Probable glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC12C2.11 PE=3 SV=2
10	AFDB:Q9LIP9	0.916	0.923	6.093E-86	677	0.512	0.516	Q9LIP9.pdb.gz	GFAT1_ARATH Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Arabidopsis thaliana OX=3702 GN=GFAT1 PE=2 SV=1
11	PDB:4amvA	0.840	0.939	2.492E-58	608	0.377	0.423	4amvA.pdb.gz	Glutamine Binding Opens the Ammonia Channel and Activates Glucosamine-6P Synthase
12	PDB:1ecfB	0.322	0.425	2.305E-14	500	0.128	0.174	1ecfB.pdb.gz	Crystal structure of glutamine phosphoribosylpyrophosphate amidotransferase from Escherichia coli.
13	PDB:4lc9A	0.355	0.416	3.295E-10	567	0.082	0.099	4lc9A.pdb.gz	Structural basis for regulation of human glucokinase by glucokinase regulatory protein.
14	PDB:1ct9A	0.273	0.363	6.772E-10	497	0.101	0.139	1ct9A.pdb.gz	Three-dimensional structure of Escherichia coli asparagine synthetase B: a short journey from substrate to product.
15	PDB:4bb9A	0.355	0.398	1.022E-9	596	0.075	0.086	4bb9A.pdb.gz	Crystal Structure of Glucokinase Regulatory Protein.
16	PDB:6gq3A	0.240	0.310	1.409E-8	509	0.091	0.122	6gq3A.pdb.gz	High-resolution crystal structure of human asparagine synthetase enables analysis of inhibitor binding and selectivity.
17	PDB:3pr3A	0.320	0.370	1.161E-7	578	0.085	0.100	3pr3A.pdb.gz	Crystal structure of Plasmodium falciparum glucose-6-phosphate isomerase (PF14_0341) in complex with fructose-6-phosphate
18	PDB:2wu8A	0.292	0.351	2.385E-7	549	0.079	0.098	2wu8A.pdb.gz
19	PDB:2cxnA	0.320	0.381	2.511E-7	557	0.081	0.099	2cxnA.pdb.gz	Crystal structures of mouse autocrine motility factor in complex with carbohydrate phosphate inhibitors provide insight into structure-activity relationship of the inhibitors
20	PDB:1iriA	0.326	0.387	4.655E-7	557	0.085	0.104	1iriA.pdb.gz	Inhibition mechanism of cytokine activity of human autocrine motility factor examined by crystal structure analyses and site-directed mutagenesis studies.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O94808	0.0	1412	682	1.000	1.000	GFPT2_HUMAN Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 OS=Homo sapiens OX=9606 GN=GFPT2 PE=1 SV=3
2	P14742	0.0	794	717	0.588	0.559	GFA1_YEAST Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GFA1 PE=1 SV=4
3	P47856	0.0	1142	697	0.793	0.776	GFPT1_MOUSE Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Mus musculus OX=10090 GN=Gfpt1 PE=1 SV=3
4	P53704	0.0	770	713	0.581	0.555	GFA1_CANAL Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GFA1 PE=1 SV=3
5	P82808	0.0	1146	681	0.793	0.794	GFPT1_RAT Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Rattus norvegicus OX=10116 GN=Gfpt1 PE=1 SV=3
6	Q06210	0.0	1142	699	0.795	0.775	GFPT1_HUMAN Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1 PE=1 SV=3
7	Q09740	0.0	745	696	0.557	0.546	GFA1_SCHPO Probable glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC12C2.11 PE=3 SV=2
8	Q19130	0.0	842	725	0.611	0.575	Q19130_CAEEL glutamine--fructose-6-phosphate transaminase (isomerizing) OS=Caenorhabditis elegans OX=6239 GN=gfat-1 PE=1 SV=1
9	Q3S344	0.0	1135	682	0.790	0.790	Q3S344_DANRE glutamine--fructose-6-phosphate transaminase (isomerizing) OS=Danio rerio OX=7955 GN=hmn PE=1 SV=1
10	Q582H1	0.0	566	659	0.440	0.455	Q582H1_TRYB2 glutamine--fructose-6-phosphate transaminase (isomerizing) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.10C21.470 PE=4 SV=1
11	Q7PLC7	0.0	931	694	0.651	0.640	Q7PLC7_DROME glutamine--fructose-6-phosphate transaminase (isomerizing) OS=Drosophila melanogaster OX=7227 GN=Gfat1 PE=1 SV=2
12	Q9LIP9	0.0	700	677	0.522	0.526	GFAT1_ARATH Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Arabidopsis thaliana OX=3702 GN=GFAT1 PE=2 SV=1
13	Q9VAW3	0.0	951	683	0.664	0.663	Q9VAW3_DROME glutamine--fructose-6-phosphate transaminase (isomerizing) OS=Drosophila melanogaster OX=7227 GN=Gfat2 PE=1 SV=1
14	Q9Z2Z9	0.0	1391	682	0.978	0.978	GFPT2_MOUSE Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 OS=Mus musculus OX=10090 GN=Gfpt2 PE=1 SV=3
15	P17169	4.04e-140	425	609	0.377	0.422	GLMS_ECOLI Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Escherichia coli (strain K12) OX=83333 GN=glmS PE=1 SV=4
16	P9WN49	1.79e-133	408	624	0.371	0.405	GLMS_MYCTU Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glmS PE=1 SV=1
17	Q6LWM9	3.27e-98	316	599	0.330	0.376	GLMS_METMP Glutamine--fructose-6-phosphate aminotransferase [isomerizing] OS=Methanococcus maripaludis (strain S2 / LL) OX=267377 GN=glmS PE=1 SV=2
18	P0AC00	1.32e-12	72.0	340	0.109	0.218	FRLB_ECOLI Fructoselysine 6-phosphate deglycase OS=Escherichia coli (strain K12) OX=83333 GN=frlB PE=1 SV=1
19	P28173	2.27e-10	65.9	510	0.085	0.114	PUR1_CHICK Amidophosphoribosyltransferase OS=Gallus gallus OX=9031 GN=PPAT PE=1 SV=1
20	Q8CIH9	6.93e-10	64.3	517	0.067	0.089	PUR1_MOUSE Amidophosphoribosyltransferase OS=Mus musculus OX=10090 GN=Ppat PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13480 Acetyltransf_6	1.2e+02	14.3	Acetyltransferase (GNAT) domain
2	PF00310 GATase_2	0.9	19.8	Glutamine amidotransferases class-II
3	PF13230 GATase_4	0.02	25.4	Glutamine amidotransferases class-II
4	PF13522 GATase_6	2.1e-14	65.2	Glutamine amidotransferase domain
5	PF13537 GATase_7	6.3e-10	50.5	Glutamine amidotransferase domain
6	PF01380 SIS	5.6e-63	222.0	SIS domain
7	PF13580 SIS_2	35	15.8	SIS domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000253778

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216410	0.983	Glucosamine-phosphate N-acetyltransferase 1
2	9606.ENSP00000405573	0.955	Glucose-6-phosphate isomerase
3	9606.ENSP00000264705	0.951	CAD protein
4	9606.ENSP00000307900	0.950	Glutamine synthetase
5	9606.ENSP00000423674	0.943	Glucosamine-6-phosphate isomerase 1
6	9606.ENSP00000264220	0.938	Amidophosphoribosyltransferase
7	9606.ENSP00000290573	0.936	Hexokinase-2
8	9606.ENSP00000349860	0.935	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1
9	9606.ENSP00000402103	0.934	Catalyzes the phosphorylation of various hexoses, such as D- glucose, D-glucosamine, D-fructose, D-mannose and 2-deoxy-D-glucose, to hexose 6-phosphate (D-glucose 6-phosphate, D-glucosamine 6-phosphate, D-fructose 6-phosphate, D-mannose 6-phosphate and 2-deoxy-D-glucose 6- phosphate, respectively) (PubMed:1637300, PubMed:25316723, PubMed:27374331). Does not phosphorylate N-acetyl-D-glucosamine . Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose 6-phosphate (By similarity). Involved in innate immunity and inflammation by acting as a pattern [...]
10	9606.ENSP00000317379	0.930	Glutaminase kidney isoform, mitochondrial
11	9606.ENSP00000455561	0.929	Uncharacterized protein
12	9606.ENSP00000292432	0.924	Catalyzes the phosphorylation of hexose, such as D-glucose and D-fructose, to hexose 6-phosphate (D-glucose 6-phosphate and D- fructose 6-phosphate, respectively) . Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose 6-phosphate .
13	9606.ENSP00000346643	0.924	Putative hexokinase HKDC1
14	9606.ENSP00000310447	0.923	Glutaminase liver isoform, mitochondrial
15	9606.ENSP00000318318	0.920	Mannose-6-phosphate isomerase
16	9606.ENSP00000295448	0.918	Glucosamine-6-phosphate deaminase 2
17	9606.ENSP00000425809	0.814	Phosphoacetylglucosamine mutase
18	9606.ENSP00000356903	0.775	UDP-N-acetylhexosamine pyrophosphorylase
19	9606.ENSP00000354850	0.771	Protein O-GlcNAcase
20	9606.ENSP00000362824	0.770	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004360	1.000	glutamine-fructose-6-phosphate transaminase (isomerizing) activity
GO:0005515	0.986	protein binding
GO:0042802	0.641	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0044238	0.994	primary metabolic process
GO:0044281	0.988	small molecule metabolic process
GO:0006807	0.988	nitrogen compound metabolic process
GO:1901135	0.967	carbohydrate derivative metabolic process
GO:0006793	0.952	phosphorus metabolic process
GO:1901576	0.720	organic substance biosynthetic process
GO:1901564	0.677	organonitrogen compound metabolic process
GO:1901137	0.677	carbohydrate derivative biosynthetic process
GO:0019637	0.631	organophosphate metabolic process
GO:0034641	0.629	cellular nitrogen compound metabolic process
GO:1901360	0.616	organic cyclic compound metabolic process
GO:0055086	0.610	nucleobase-containing small molecule metabolic process
GO:0006796	0.585	phosphate-containing compound metabolic process
GO:0044249	0.481	cellular biosynthetic process
GO:0006040	0.419	amino sugar metabolic process
GO:0009225	0.406	nucleotide-sugar metabolic process
GO:0044271	0.392	cellular nitrogen compound biosynthetic process
GO:0034654	0.368	nucleobase-containing compound biosynthetic process
GO:0050896	0.345	response to stimulus
GO:0046349	0.342	amino sugar biosynthetic process
GO:0065007	0.315	biological regulation
GO:0050789	0.310	regulation of biological process
GO:0019752	0.301	carboxylic acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043226	0.928	organelle
GO:0043227	0.923	membrane-bounded organelle
GO:0043230	0.599	extracellular organelle
GO:0043229	0.591	intracellular organelle
GO:0065010	0.590	extracellular membrane-bounded organelle
GO:1903561	0.549	extracellular vesicle
GO:0005615	0.538	extracellular space
GO:0070062	0.474	extracellular exosome
GO:0043231	0.427	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13237	1.000	D-fructose 6-phosphate + L-glutamine = D-glucosamine 6-phosphate + L-glutamate
EC:2.6.1.16	1.000	glutamine--fructose-6-phosphate transaminase (isomerizing).

[back to server]