StarFunc result for job id O94812

User Input

>input (1187 residues)
MRPRGAAFAAGPPGDLHLGTAIGFAGAIWRSRSPAMSTLLDIKSSVLRQVQVCPSFRRRT
EQDPGSASADPQEPATGAWKPGDGVEFFAHMRLMLKKGEGRQGLPCLEVPLRSGSPAPPE
PVDPSLGLRALAPEEVEMLYEEALYTVLYRAGTMGPDQVDDEEALLSYLQQVFGTSLEEH
TEAIERVRKAKAPTYALKVSVMRAKNLLAKDPNGFSDPYCMLGILPASDATREPRAQKEQ
RFGFRKGSKRGGPLPAKCIQVTEVKSSTLNPVWKEHFLFEIEDVSTDQLHLDIWDHDDDV
SLVEACRKLNEVIGLKGMGRYFKQIVKSARANGTAGPTEDHTDDFLGCLNIPVREVPVAG
VDRWFKLEPRSSASRVQGHCHLVLKLITTQRDTAMSQRGRSGFLSHLLLLSHLLRLEHSA
EEPNSSSWRGELSTPAATILCLHGAQSNLSPLQLAVLHWQVSSRHHQTCTLDYSYLLGLL
EDMQAHWEEAPSLPQEQEESLADSLSAFSEFGLQLLRQLRDYFPATNSTAVHRLELLLKC
LGKLQLFQPSFEICPFESELNMDIAAALKRGNREWYDRILNDKSPREQPGPQRLPGLVVL
ADAVYDDLQFCYSVYASLFHSILNVDVFTLTFRQLERLVAEEAWVLTEELSPKMTLEVAS
GLFELYLTLADLQRFWDSIPGRDSRSLALAGIHAPFLPAVKLWFQVLRDQAKWRLQGAVD
MDTLEPVDASSRHSSSAATAGLCLSHIQELWVRLAWPDPAQAQGLGTQLGQDVCEATLFY
TELLRKKVDTQPGAAGEAVSEALCVVLNNVELVRKAAGQALKGLAWPEGATGPEGVLPRP
LLSCTQALDDDLQREAHTVTAHLTSKMVGDIRKYVQHISLSPDSIQNDEAVAPLMKYLDE
KLALLNASLVKGNLSRVLEALWELLLQAILQALGANRDVSADFYSRFHFTLEALVSFFHA
EGQGLPLESLRDGSYKRLKEELRLHKCSTRECIEQFYLDKLKQRTLEQNRFGRLSVRCHY
EAAEQRLAVEVLHAADLLPLDANGLSDPFVIVELGPPHLFPLVRSQRTQVKTRTLHPVYD
ELFYFSVPAEACRRRAACVLFTVMDHDWLSTNDFAGEAALGLGGVTGVARPQVGGGARAG
QPVTLHLCRPRAQVRSALRRLEGRTSKEAQEFVKKLKELEKCMEADP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O94812	1.000	1.000	0.000	1187	1.000	1.000	O94812.pdb.gz	BAIP3_HUMAN BAI1-associated protein 3 OS=Homo sapiens OX=9606 GN=BAIAP3 PE=1 SV=2
2	AFDB:Q80TT2	0.894	0.934	0.000	1134	0.849	0.889	Q80TT2.pdb.gz	BAIP3_MOUSE BAI1-associated protein 3 OS=Mus musculus OX=10090 GN=Baiap3 PE=1 SV=4
3	AFDB:Q70J99	0.579	0.625	4.492E-72	1090	0.313	0.341	Q70J99.pdb.gz	UN13D_HUMAN Protein unc-13 homolog D OS=Homo sapiens OX=9606 GN=UNC13D PE=1 SV=1
4	AFDB:Q9R189	0.565	0.611	3.907E-70	1088	0.313	0.342	Q9R189.pdb.gz	UN13D_RAT Protein unc-13 homolog D OS=Rattus norvegicus OX=10116 GN=Unc13d PE=1 SV=1
5	AFDB:Q9VBY8	0.465	0.475	4.174E-50	1153	0.227	0.234	Q9VBY8.pdb.gz	UN13B_DROME Protein unc-13 homolog 4B OS=Drosophila melanogaster OX=7227 GN=stac PE=1 SV=5
6	AFDB:Q9Z1N9	0.430	0.348	8.167E-41	1602	0.193	0.143	Q9Z1N9.pdb.gz	UN13B_MOUSE Protein unc-13 homolog B OS=Mus musculus OX=10090 GN=Unc13b PE=1 SV=2
7	AFDB:Q9UPW8	0.454	0.347	3.118E-40	1703	0.185	0.129	Q9UPW8.pdb.gz	UN13A_HUMAN Protein unc-13 homolog A OS=Homo sapiens OX=9606 GN=UNC13A PE=2 SV=4
8	AFDB:Q62768	0.435	0.330	8.603E-40	1735	0.193	0.132	Q62768.pdb.gz	UN13A_RAT Protein unc-13 homolog A OS=Rattus norvegicus OX=10116 GN=Unc13a PE=1 SV=1
9	AFDB:Q62769	0.432	0.346	1.400E-39	1622	0.188	0.137	Q62769.pdb.gz	UN13B_RAT Protein unc-13 homolog B OS=Rattus norvegicus OX=10116 GN=Unc13b PE=1 SV=2
10	AFDB:Q8NB66	0.450	0.282	4.545E-39	2214	0.186	0.100	Q8NB66.pdb.gz	UN13C_HUMAN Protein unc-13 homolog C OS=Homo sapiens OX=9606 GN=UNC13C PE=2 SV=3
11	PDB:3pfqA	0.101	0.222	9.033E-8	523	0.033	0.075	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
12	PDB:5a1uE	0.080	0.103	1.567E-5	824	0.069	0.100	5a1uE.pdb.gz
13	PDB:1cjyA	0.094	0.171	2.766E-5	633	0.045	0.085	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
14	PDB:5ixcA	0.064	0.109	3.827E-5	684	0.059	0.102	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
15	PDB:5iz5B	0.066	0.104	4.882E-5	746	0.061	0.097	5iz5B.pdb.gz
16	PDB:5izrC	0.064	0.111	5.515E-5	659	0.058	0.105	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
17	PDB:4ajwB	0.083	0.119	1.294E-4	792	0.068	0.102	4ajwB.pdb.gz	Discovery and Optimization of New Benzimidazole- and Benzoxazole-Pyrimidone Selective Pi3Kbeta Inhibitors for the Treatment of Phosphatase and Tensin Homologue (Pten)-Deficient Cancers.
18	PDB:5itdA	0.090	0.105	1.790E-4	995	0.083	0.099	5itdA.pdb.gz	Discovery and Pharmacological Characterization of Novel Quinazoline-Based PI3K Delta-Selective Inhibitors.
19	PDB:7lq1A	0.085	0.104	1.941E-4	950	0.086	0.107	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
20	PDB:5swpA	0.093	0.103	2.193E-4	1060	0.072	0.081	5swpA.pdb.gz	Identification of allosteric binding sites for PI3K alpha oncogenic mutant specific inhibitor design.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O94812	0.0	2427	1187	1.000	1.000	BAIP3_HUMAN BAI1-associated protein 3 OS=Homo sapiens OX=9606 GN=BAIAP3 PE=1 SV=2
2	Q80TT2	0.0	2016	1150	0.863	0.890	BAIP3_MOUSE BAI1-associated protein 3 OS=Mus musculus OX=10090 GN=Baiap3 PE=1 SV=4
3	Q70J99	4.71e-173	541	1090	0.312	0.339	UN13D_HUMAN Protein unc-13 homolog D OS=Homo sapiens OX=9606 GN=UNC13D PE=1 SV=1
4	B2RUP2	5.00e-173	541	1085	0.314	0.344	UN13D_MOUSE Protein unc-13 homolog D OS=Mus musculus OX=10090 GN=Unc13d PE=1 SV=2
5	Q9R189	1.64e-170	535	1088	0.312	0.340	UN13D_RAT Protein unc-13 homolog D OS=Rattus norvegicus OX=10116 GN=Unc13d PE=1 SV=1
6	Q9VBY8	1.27e-81	293	1153	0.217	0.224	UN13B_DROME Protein unc-13 homolog 4B OS=Drosophila melanogaster OX=7227 GN=stac PE=1 SV=5
7	K7EN81	2.37e-45	168	311	0.086	0.328	K7EN81_HUMAN Unc-13 homolog D (Fragment) OS=Homo sapiens OX=9606 GN=UNC13D PE=1 SV=2
8	O14795	3.78e-25	116	1591	0.179	0.134	UN13B_HUMAN Protein unc-13 homolog B OS=Homo sapiens OX=9606 GN=UNC13B PE=1 SV=2
9	Q9Z1N9	4.12e-25	115	1602	0.181	0.134	UN13B_MOUSE Protein unc-13 homolog B OS=Mus musculus OX=10090 GN=Unc13b PE=1 SV=2
10	Q8NB66	1.05e-24	114	2214	0.206	0.110	UN13C_HUMAN Protein unc-13 homolog C OS=Homo sapiens OX=9606 GN=UNC13C PE=2 SV=3
11	Q8K0T7	1.16e-24	114	2210	0.209	0.112	UN13C_MOUSE Protein unc-13 homolog C OS=Mus musculus OX=10090 GN=Unc13c PE=1 SV=3
12	Q62770	7.33e-24	112	2204	0.211	0.114	UN13C_RAT Protein unc-13 homolog C OS=Rattus norvegicus OX=10116 GN=Unc13c PE=1 SV=3
13	Q8T049	8.40e-23	108	1508	0.183	0.144	Q8T049_DROME LD28927p OS=Drosophila melanogaster OX=7227 GN=unc-13 PE=2 SV=1
14	Q9U4K9	2.29e-22	107	1752	0.182	0.123	Q9U4K9_DROME UNC-13 OS=Drosophila melanogaster OX=7227 GN=unc-13 PE=2 SV=1
15	Q62769	3.05e-21	103	1622	0.180	0.132	UN13B_RAT Protein unc-13 homolog B OS=Rattus norvegicus OX=10116 GN=Unc13b PE=1 SV=2
16	O96959	3.48e-21	103	1304	0.181	0.165	O96959_DROME UNC-13 protein (Fragment) OS=Drosophila melanogaster OX=7227 GN=unc-13 PE=2 SV=1
17	Q4KUS2	7.01e-20	99.0	1712	0.141	0.098	UN13A_MOUSE Protein unc-13 homolog A OS=Mus musculus OX=10090 GN=Unc13a PE=1 SV=3
18	Q9UPW8	2.41e-19	97.1	1703	0.141	0.098	UN13A_HUMAN Protein unc-13 homolog A OS=Homo sapiens OX=9606 GN=UNC13A PE=2 SV=4
19	P27715	5.10e-19	96.3	2155	0.184	0.102	UNC13_CAEEL Phorbol ester/diacylglycerol-binding protein unc-13 OS=Caenorhabditis elegans OX=6239 GN=unc-13 PE=1 SV=4
20	G5EDN9	1.11e-18	95.1	1819	0.184	0.120	G5EDN9_CAEEL Phorbol ester/diacylglycerol-binding protein unc-13 OS=Caenorhabditis elegans OX=6239 GN=unc-13 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	1.7e-27	107.1	C2 domain
2	PF06292 MUN	0.00028	31.6	MUN domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000324510

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000430945	0.885	Adhesion G protein-coupled receptor B1
2	9606.ENSP00000361418	0.770	Importin-13
3	9606.ENSP00000426174	0.762	Coiled-coil domain containing 169
4	9606.ENSP00000362080	0.740	Synaptotagmin-like protein 4
5	9606.ENSP00000329654	0.709	Polypeptide N-acetylgalactosaminyltransferase 17
6	9606.ENSP00000405577	0.689	CXADR-like membrane protein
7	9606.ENSP00000019103	0.673	Secretin receptor
8	9606.ENSP00000316338	0.638	Brain-specific angiogenesis inhibitor 1-associated protein 2
9	9606.ENSP00000327611	0.624	Potassium channel subfamily K member 12
10	9606.ENSP00000380488	0.558	Polypeptide N-acetylgalactosaminyltransferase 9
11	9606.ENSP00000359073	0.551	Guanine nucleotide exchange factor VAV3
12	9606.ENSP00000469332	0.533	Gamma-aminobutyric acid receptor subunit theta
13	9606.ENSP00000423674	0.518	Glucosamine-6-phosphate isomerase 1
14	9606.ENSP00000413707	0.513	Leucine-rich repeat-containing protein 15

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005543	0.994	phospholipid binding
GO:0005509	0.947	calcium ion binding
GO:0000149	0.945	SNARE binding
GO:0019905	0.921	syntaxin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0009987	0.984	cellular process
GO:0051179	0.933	localization
GO:0051234	0.914	establishment of localization
GO:0006810	0.904	transport
GO:0060341	0.883	regulation of cellular localization
GO:0016192	0.882	vesicle-mediated transport
GO:0071840	0.875	cellular component organization or biogenesis
GO:0016043	0.873	cellular component organization
GO:0032880	0.854	regulation of protein localization
GO:0048522	0.843	positive regulation of cellular process
GO:0050804	0.801	modulation of chemical synaptic transmission
GO:0051641	0.770	cellular localization
GO:0050896	0.720	response to stimulus
GO:0050708	0.714	regulation of protein secretion
GO:0023052	0.699	signaling
GO:0007154	0.699	cell communication
GO:0051050	0.695	positive regulation of transport
GO:0010647	0.694	positive regulation of cell communication
GO:0023056	0.692	positive regulation of signaling
GO:1903532	0.692	positive regulation of secretion by cell
GO:0051649	0.668	establishment of localization in cell
GO:0017157	0.660	regulation of exocytosis
GO:0051588	0.625	regulation of neurotransmitter transport
GO:0051222	0.621	positive regulation of protein transport
GO:0001505	0.616	regulation of neurotransmitter levels
GO:0050714	0.608	positive regulation of protein secretion
GO:1903305	0.602	regulation of regulated secretory pathway
GO:0010817	0.545	regulation of hormone levels
GO:0051716	0.525	cellular response to stimulus
GO:0050796	0.516	regulation of insulin secretion
GO:0007165	0.447	signal transduction
GO:0017158	0.437	regulation of calcium ion-dependent exocytosis
GO:0051239	0.410	regulation of multicellular organismal process
GO:0032024	0.401	positive regulation of insulin secretion
GO:0016482	0.382	cytosolic transport
GO:0061178	0.370	regulation of insulin secretion involved in cellular response to glucose stimulus
GO:0051590	0.367	positive regulation of neurotransmitter transport
GO:0032502	0.355	developmental process
GO:0006996	0.345	organelle organization
GO:0046928	0.314	regulation of neurotransmitter secretion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0016020	0.997	membrane
GO:0043227	0.996	membrane-bounded organelle
GO:0043229	0.996	intracellular organelle
GO:0012505	0.993	endomembrane system
GO:0043231	0.986	intracellular membrane-bounded organelle
GO:0005829	0.973	cytosol
GO:0031410	0.968	cytoplasmic vesicle
GO:0005886	0.961	plasma membrane
GO:0031090	0.928	organelle membrane
GO:0030054	0.758	cell junction
GO:0045202	0.707	synapse
GO:0031984	0.698	organelle subcompartment
GO:0005794	0.677	Golgi apparatus
GO:0030659	0.657	cytoplasmic vesicle membrane
GO:0005768	0.632	endosome
GO:0098588	0.624	bounding membrane of organelle
GO:0098791	0.491	Golgi apparatus subcompartment
GO:0005802	0.481	trans-Golgi network
GO:0070013	0.462	intracellular organelle lumen
GO:0005634	0.342	nucleus
GO:0032588	0.321	trans-Golgi network membrane
GO:0055037	0.316	recycling endosome
GO:0005576	0.315	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]