StarFunc result for job id O94817

User Input

>input (140 residues)
MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLK
AVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLY
ECFGSDGKLVLHYCKSQAWG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9CQY1	0.750	0.745	1.100E-25	141	0.893	0.887	Q9CQY1.pdb.gz	ATG12_MOUSE Ubiquitin-like protein ATG12 OS=Mus musculus OX=10090 GN=Atg12 PE=1 SV=1
2	AFDB:C1IDX9	0.650	0.488	5.865E-25	187	1.000	0.749	C1IDX9.pdb.gz	C1IDX9_HUMAN Ubiquitin-like protein ATG12 OS=Homo sapiens OX=9606 GN=ATG12 PE=1 SV=1
3	AFDB:Q2TBJ5	0.768	0.763	2.392E-24	141	0.857	0.851	Q2TBJ5.pdb.gz	ATG12_RAT Ubiquitin-like protein ATG12 OS=Rattus norvegicus OX=10116 GN=Atg12 PE=2 SV=1
4	AFDB:Q9VTU1	0.637	0.799	5.884E-15	111	0.421	0.532	Q9VTU1.pdb.gz	APG12_DROME Autophagy protein 12-like OS=Drosophila melanogaster OX=7227 GN=Atg12 PE=3 SV=3
5	AFDB:Q86CR6	0.612	0.688	1.388E-11	124	0.257	0.290	Q86CR6.pdb.gz	ATG12_DICDI Ubiquitin-like protein atg12 OS=Dictyostelium discoideum OX=44689 GN=atg12 PE=3 SV=1
6	AFDB:Q10931	0.597	0.705	4.951E-11	118	0.264	0.314	Q10931.pdb.gz	ATG12_CAEEL Ubiquitin-like protein atg-12 OS=Caenorhabditis elegans OX=6239 GN=lgg-3 PE=1 SV=1
7	AFDB:Q8S924	0.586	0.838	1.034E-10	96	0.286	0.417	Q8S924.pdb.gz	AT12A_ARATH Ubiquitin-like protein ATG12A OS=Arabidopsis thaliana OX=3702 GN=ATG12A PE=1 SV=1
8	AFDB:Q9US24	0.604	0.639	1.034E-10	132	0.229	0.242	Q9US24.pdb.gz	ATG12_SCHPO Ubiquitin-like protein ATG12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atg12 PE=3 SV=1
9	AFDB:P38316	0.594	0.451	5.155E-10	186	0.236	0.177	P38316.pdb.gz	ATG12_YEAST Ubiquitin-like protein ATG12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATG12 PE=1 SV=1
10	AFDB:Q9LRP7	0.607	0.734	1.967E-9	115	0.150	0.183	Q9LRP7.pdb.gz	ATG8I_ARATH Autophagy-related protein 8i OS=Arabidopsis thaliana OX=3702 GN=ATG8I PE=1 SV=1
11	PDB:5azfA	0.596	0.696	2.713E-8	119	0.143	0.168	5azfA.pdb.gz	Structural Basis of the Differential Function of the Two C. elegans Atg8 Homologs, LGG-1 and LGG-2, in Autophagy.
12	PDB:7bruA	0.585	0.593	3.546E-8	138	0.150	0.152	7bruA.pdb.gz
13	PDB:7lswC	0.590	0.570	4.635E-8	145	0.150	0.145	7lswC.pdb.gz
14	PDB:5yipA	0.586	0.662	5.666E-8	123	0.143	0.163	5yipA.pdb.gz	Potent and specific Atg8-targeting autophagy inhibitory peptides from giant ankyrins.
15	PDB:7yo8A	0.561	0.561	1.107E-7	140	0.136	0.136	7yo8A.pdb.gz
16	PDB:5azhA	0.569	0.623	1.183E-7	127	0.129	0.142	5azhA.pdb.gz
17	PDB:6aagC	0.596	0.600	1.547E-7	139	0.171	0.173	6aagC.pdb.gz
18	PDB:3wanB	0.594	0.647	1.891E-7	128	0.143	0.156	3wanB.pdb.gz
19	PDB:6aafA	0.572	0.707	1.891E-7	112	0.150	0.188	6aafA.pdb.gz	Lipidation-independent vacuolar functions of Atg8 rely on its noncanonical interaction with a vacuole membrane protein
20	PDB:7aa8C	0.560	0.589	2.162E-7	133	0.143	0.150	7aa8C.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O94817	1.69e-100	285	140	1.000	1.000	ATG12_HUMAN Ubiquitin-like protein ATG12 OS=Homo sapiens OX=9606 GN=ATG12 PE=1 SV=1
2	C1IDX9	3.76e-100	286	187	1.000	0.749	C1IDX9_HUMAN Ubiquitin-like protein ATG12 OS=Homo sapiens OX=9606 GN=ATG12 PE=1 SV=1
3	Q9CQY1	2.63e-88	255	141	0.893	0.887	ATG12_MOUSE Ubiquitin-like protein ATG12 OS=Mus musculus OX=10090 GN=Atg12 PE=1 SV=1
4	Q2TBJ5	5.11e-83	241	141	0.857	0.851	ATG12_RAT Ubiquitin-like protein ATG12 OS=Rattus norvegicus OX=10116 GN=Atg12 PE=2 SV=1
5	Q9VTU1	6.47e-39	129	111	0.421	0.532	APG12_DROME Autophagy protein 12-like OS=Drosophila melanogaster OX=7227 GN=Atg12 PE=3 SV=3
6	Q9LVK3	1.13e-21	84.7	94	0.300	0.447	AT12B_ARATH Ubiquitin-like protein ATG12B OS=Arabidopsis thaliana OX=3702 GN=ATG12B PE=1 SV=1
7	Q8S924	2.65e-21	84.0	96	0.286	0.417	AT12A_ARATH Ubiquitin-like protein ATG12A OS=Arabidopsis thaliana OX=3702 GN=ATG12A PE=1 SV=1
8	Q9US24	6.42e-19	79.0	132	0.229	0.242	ATG12_SCHPO Ubiquitin-like protein ATG12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atg12 PE=3 SV=1
9	Q86CR6	1.17e-18	78.2	124	0.236	0.266	ATG12_DICDI Ubiquitin-like protein atg12 OS=Dictyostelium discoideum OX=44689 GN=atg12 PE=3 SV=1
10	Q10931	9.10e-16	70.5	118	0.264	0.314	ATG12_CAEEL Ubiquitin-like protein atg-12 OS=Caenorhabditis elegans OX=6239 GN=lgg-3 PE=1 SV=1
11	P38316	9.07e-11	58.9	186	0.200	0.151	ATG12_YEAST Ubiquitin-like protein ATG12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATG12 PE=1 SV=1
12	Q8S925	4.23e-04	39.7	119	0.164	0.193	ATG8H_ARATH Autophagy-related protein 8h OS=Arabidopsis thaliana OX=3702 GN=ATG8H PE=1 SV=1
13	F2YHL2	0.008	36.2	119	0.164	0.193	F2YHL2_SOLLC Autophagy-related protein OS=Solanum lycopersicum OX=4081 PE=1 SV=1
14	Q8S927	0.029	34.7	119	0.136	0.160	ATG8C_ARATH Autophagy-related protein 8c OS=Arabidopsis thaliana OX=3702 GN=ATG8C PE=1 SV=1
15	Q8LEM4	0.032	34.7	122	0.150	0.172	ATG8A_ARATH Autophagy-related protein 8a OS=Arabidopsis thaliana OX=3702 GN=ATG8A PE=1 SV=2
16	Q8VYK7	0.045	34.3	121	0.150	0.174	ATG8F_ARATH Autophagy-related protein 8f OS=Arabidopsis thaliana OX=3702 GN=ATG8F PE=1 SV=1
17	Q9XEB5	0.047	34.3	122	0.150	0.172	ATG8B_ARATH Autophagy-related protein 8b OS=Arabidopsis thaliana OX=3702 GN=ATG8B PE=1 SV=1
18	M1C146	0.063	33.9	119	0.143	0.168	ATG8C_SOLTU Autophagy-related protein 8C-like OS=Solanum tuberosum OX=4113 GN=ATG8CL PE=1 SV=1
19	A8MS84	0.072	33.9	137	0.150	0.153	A8MS84_ARATH Autophagy-related protein OS=Arabidopsis thaliana OX=3702 GN=APG8A PE=1 SV=1
20	P0C075	0.11	33.5	135	0.157	0.163	ATG8_CANAL Autophagy-related protein 8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ATG8 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04110 APG12	1.3e-37	139.4	Ubiquitin-like autophagy protein Apg12
2	PF02991 ATG8	0.008	27.7	Autophagy protein Atg8 ubiquitin like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000425107

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000037243	0.999	Gamma-aminobutyric acid receptor-associated protein-like 2
2	9606.ENSP00000266458	0.999	Gamma-aminobutyric acid receptor-associated protein-like 1
3	9606.ENSP00000282185	0.999	Ubiquitin-like-conjugating enzyme ATG10
4	9606.ENSP00000283290	0.999	Ubiquitin-like-conjugating enzyme ATG3
5	9606.ENSP00000346437	0.999	Ubiquitin-like modifier-activating enzyme ATG7
6	9606.ENSP00000358072	0.999	Autophagy protein 5
7	9606.ENSP00000375872	0.999	Autophagy-related protein 16-1
8	9606.ENSP00000369213	0.998	Probable ATP-dependent RNA helicase DDX58
9	9606.ENSP00000288828	0.995	WD repeat domain phosphoinositide-interacting protein 2
10	9606.ENSP00000401980	0.995	Mitochondrial antiviral-signaling protein
11	9606.ENSP00000404923	0.994	Tectonin beta-propeller repeat-containing protein 1
12	9606.ENSP00000306866	0.993	Gamma-aminobutyric acid receptor-associated protein
13	9606.ENSP00000355231	0.988	Beclin-1
14	9606.ENSP00000268607	0.982	Microtubule-associated proteins 1A/1B light chain 3B
15	9606.ENSP00000025008	0.981	RB1-inducible coiled-coil protein 1
16	9606.ENSP00000262039	0.981	Phosphatidylinositol 3-kinase catalytic subunit type 3
17	9606.ENSP00000349785	0.980	Microtubule-associated proteins 1A/1B light chain 3C
18	9606.ENSP00000247178	0.973	Beclin 1-associated autophagy-related key regulator
19	9606.ENSP00000349205	0.972	Phosphoinositide 3-kinase regulatory subunit 4
20	9606.ENSP00000363970	0.972	Microtubule-associated proteins 1A/1B light chain 3A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.996	cellular metabolic process
GO:0044248	0.989	cellular catabolic process
GO:0061919	0.988	process utilizing autophagic mechanism
GO:0006914	0.984	autophagy
GO:0050789	0.968	regulation of biological process
GO:0019222	0.896	regulation of metabolic process
GO:0050794	0.823	regulation of cellular process
GO:0016236	0.801	macroautophagy
GO:0071704	0.641	organic substance metabolic process
GO:0048583	0.634	regulation of response to stimulus
GO:0048519	0.623	negative regulation of biological process
GO:0016043	0.526	cellular component organization
GO:0044238	0.496	primary metabolic process
GO:0043170	0.488	macromolecule metabolic process
GO:0006807	0.475	nitrogen compound metabolic process
GO:0006996	0.465	organelle organization
GO:0080134	0.460	regulation of response to stress
GO:1901564	0.437	organonitrogen compound metabolic process
GO:0048518	0.435	positive regulation of biological process
GO:0031323	0.420	regulation of cellular metabolic process
GO:0050896	0.414	response to stimulus
GO:0019538	0.396	protein metabolic process
GO:0060255	0.352	regulation of macromolecule metabolic process
GO:0031347	0.347	regulation of defense response
GO:0002831	0.332	regulation of response to biotic stimulus
GO:0032101	0.318	regulation of response to external stimulus
GO:0009894	0.309	regulation of catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0016020	1.000	membrane
GO:0005737	1.000	cytoplasm
GO:1902494	0.982	catalytic complex
GO:0005829	0.981	cytosol
GO:0031090	0.977	organelle membrane
GO:0031981	0.976	nuclear lumen
GO:0005654	0.972	nucleoplasm
GO:0031982	0.958	vesicle
GO:0031410	0.947	cytoplasmic vesicle
GO:0098588	0.944	bounding membrane of organelle
GO:0005773	0.837	vacuole
GO:1990234	0.816	transferase complex
GO:0005776	0.574	autophagosome
GO:0030659	0.382	cytoplasmic vesicle membrane
GO:0030139	0.365	endocytic vesicle
GO:0000407	0.308	phagophore assembly site

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]