StarFunc result for job id O94822

User Input

>input (1766 residues)
MGGKNKQRTKGNLRPSNSGRAAELLAKEQGTVPGFIGFGTSQSDLGYVPAIQGAEEIDSL
VDSDFRMVLRKLSKKDVTTKLKAMQEFGTMCTERDTETVKGVLPYWPRIFCKISLDHDRR
VREATQQAFEKLILKVKKQLAPYLKSLMGYWLMAQCDTYTPAAFAAKDAFEAAFPPSKQP
EAIAFCKDEITSVLQDHLIKETPDTLSDPQTVPEEEREAKFYRVVTCSLLALKRLLCLLP
DNELDSLEEKFKSLLSQNKFWKYGKHSVPQIRSAYFELVSALCQRIPQLMKEEASKVSPS
VLLSIDDSDPIVCPALWEAVLYTLTTIEDCWLHVNAKKSVFPKLSTVIREGGRGLATVIY
PYLLPFISKLPQSITNPKLDFFKNFLTSLVAGLSTERTKTSSLESSAVISAFFECLRFIM
QQNLGEEEIEQMLVNDQLIPFIDAVLKDPGLQHGQLFNHLAETLSSWEAKADTEKDEKTA
HNLENVLIHFWERLSEICVAKISEPEADVESVLGVSNLLQVLQKPKSSLKSSKKKNGKVR
FADEILESNKENEKCVSSEGEKIEGWELTTEPSLTHNSSGLLSPLRKKPLEDLVCKLADI
SINYVNERKSEQHLRFLSTLLDSFSSSRVFKMLLGDEKQSIVQAKPLEIAKLVQKNPAVQ
FLYQKLIGWLNEDQRKDFGFLVDILYSALRCCDNDMERKKVLDDLTKVDLKWNSLLKIIE
KACPSSDKHALVTPWLKGDILGEKLVNLADCLCNEDLESRVSSESHFSERWTLLSLVLSQ
HVKNDYLIGDVYVERIIVRLHETLFKTKKLSEAESSDSSVSFICDVAYNYFSSAKGCLLM
PSSEDLLLTLFQLCAQSKEKTHLPDFLICKLKNTWLSGVNLLVHQTDSSYKESTFLHLSA
LWLKNQVQASSLDINSLQVLLSAVDDLLNTLLESEDSYLMGVYIGSVMPNDSEWEKMRQS
LPMQWLHRPLLEGRLSLNYECFKTDFKEQDIKTLPSHLCTSALLSKMVLIALRKETVLEN
NELEKIIAELLYSLQWCEELDNPPIFLIGFCEILQKMNITYDNLRVLGNTSGLLQLLFNR
SREHGTLWSLIIAKLILSRSISSDEVKPHYKRKESFFPLTEGNLHTIQSLCPFLSKEEKK
EFSAQCIPALLGWTKKDLCSTNGGFGHLAIFNSCLQTKSIDDGELLHGILKIIISWKKEH
EDIFLFSCNLSEASPEVLGVNIEIIRFLSLFLKYCSSPLAESEWDFIMCSMLAWLETTSE
NQALYSIPLVQLFACVSCDLACDLSAFFDSTTLDTIGNLPVNLISEWKEFFSQGIHSLLL
PILVTVTGENKDVSETSFQNAMLKPMCETLTYISKEQLLSHKLPARLVADQKTNLPEYLQ
TLLNTLAPLLLFRARPVQIAVYHMLYKLMPELPQYDQDNLKSYGDEEEEPALSPPAALMS
LLSIQEDLLENVLGCIPVGQIVTIKPLSEDFCYVLGYLLTWKLILTFFKAASSQLRALYS
MYLRKTKSLNKLLYHLFRLMPENPTYAETAVEVPNKDPKTFFTEELQLSIRETTMLPYHI
PHLACSVYHMTLKDLPAMVRLWWNSSEKRVFNIVDRFTSKYVSSVLSFQEISSVQTSTQL
FNGMTVKARATTREVMATYTIEDIVIELIIQLPSNYPLGSIIVESGKRVGVAVQQWRNWM
LQLSTYLTHQNGSIMEGLALWKNNVDKRFEGVEDCMICFSVIHGFNYSLPKKACRTCKKK
FHSACLYKWFTSSNKSTCPLCRETFF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O94822	1.000	1.000	0.000	1766	1.000	1.000	O94822.pdb.gz	LTN1_HUMAN E3 ubiquitin-protein ligase listerin OS=Homo sapiens OX=9606 GN=LTN1 PE=1 SV=6
2	AFDB:Q6A009	0.771	0.771	0.000	1767	0.854	0.853	Q6A009.pdb.gz	LTN1_MOUSE E3 ubiquitin-protein ligase listerin OS=Mus musculus OX=10090 GN=Ltn1 PE=1 SV=3
3	AFDB:Q9VW09	0.639	0.645	3.933E-61	1747	0.251	0.254	Q9VW09.pdb.gz	LTN1_DROME E3 ubiquitin-protein ligase listerin OS=Drosophila melanogaster OX=7227 GN=Ltn1 PE=1 SV=2
4	AFDB:O74349	0.335	0.361	4.862E-34	1610	0.184	0.202	O74349.pdb.gz	LTN1_SCHPO E3 ubiquitin-protein ligase listerin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rkr1 PE=3 SV=1
5	AFDB:Q04781	0.296	0.327	4.275E-31	1562	0.168	0.190	Q04781.pdb.gz	LTN1_YEAST E3 ubiquitin-protein ligase listerin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RKR1 PE=1 SV=1
6	AFDB:Q385R6	0.278	0.285	1.236E-25	1706	0.152	0.158	Q385R6.pdb.gz	Q385R6_TRYB2 E3 ubiquitin-protein ligase listerin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2670 PE=3 SV=1
7	AFDB:Q9VKY2	0.165	0.213	1.828E-9	1248	0.096	0.135	Q9VKY2.pdb.gz	CAND1_DROME Cullin-associated NEDD8-dissociated protein 1 OS=Drosophila melanogaster OX=7227 GN=Cand1 PE=2 SV=1
8	AFDB:Q8L5Y6	0.172	0.223	2.031E-9	1219	0.096	0.139	Q8L5Y6.pdb.gz	CAND1_ARATH Cullin-associated NEDD8-dissociated protein 1 OS=Arabidopsis thaliana OX=3702 GN=CAND1 PE=1 SV=1
9	AFDB:E9PVA8	0.125	0.095	4.556E-9	2671	0.106	0.070	E9PVA8.pdb.gz	GCN1_MOUSE Stalled ribosome sensor GCN1 OS=Mus musculus OX=10090 GN=Gcn1 PE=1 SV=1
10	AFDB:Q94FN2	0.096	0.097	5.062E-9	1978	0.123	0.110	Q94FN2.pdb.gz	MOR1_ARATH Protein MOR1 OS=Arabidopsis thaliana OX=3702 GN=MOR1 PE=1 SV=1
11	PDB:4a0cA	0.140	0.185	5.912E-9	1155	0.102	0.157	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
12	PDB:7mq8SP	0.129	0.120	7.299E-9	1993	0.124	0.110	7mq8SP.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:3j92z	0.072	0.901	7.560E-9	130	0.073	0.992	3j92z.pdb.gz	Structure and Assembly Pathway of the Ribosome Quality Control Complex.
14	PDB:7jq9A	0.160	0.130	1.280E-8	2427	0.123	0.090	7jq9A.pdb.gz
15	PDB:6x9oA	0.113	0.096	3.191E-8	2425	0.126	0.092	6x9oA.pdb.gz
16	PDB:7mqaLM	0.086	0.079	5.798E-8	2041	0.119	0.103	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:7sukSP	0.126	0.108	6.672E-8	2234	0.127	0.101	7sukSP.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
18	PDB:7mqaSP	0.095	0.082	7.679E-8	2485	0.128	0.091	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:6yejA	0.146	0.132	9.481E-8	2046	0.122	0.105	6yejA.pdb.gz
20	PDB:7nfeA	0.172	0.103	9.819E-8	3585	0.125	0.061	7nfeA.pdb.gz	Cryo-EM of NHEJ supercomplexes provides insights into DNA repair.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H7BYG8	0.0	1422	767	0.413	0.950	H7BYG8_HUMAN E3 ubiquitin-protein ligase listerin OS=Homo sapiens OX=9606 GN=LTN1 PE=1 SV=2
2	O94822	0.0	3622	1766	1.000	1.000	LTN1_HUMAN E3 ubiquitin-protein ligase listerin OS=Homo sapiens OX=9606 GN=LTN1 PE=1 SV=6
3	Q6A009	0.0	3101	1767	0.854	0.854	LTN1_MOUSE E3 ubiquitin-protein ligase listerin OS=Mus musculus OX=10090 GN=Ltn1 PE=1 SV=3
4	Q9VW09	7.91e-76	282	1747	0.119	0.120	LTN1_DROME E3 ubiquitin-protein ligase listerin OS=Drosophila melanogaster OX=7227 GN=Ltn1 PE=1 SV=2
5	Q04781	1.49e-44	180	1562	0.053	0.060	LTN1_YEAST E3 ubiquitin-protein ligase listerin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RKR1 PE=1 SV=1
6	O74349	5.98e-44	178	1610	0.060	0.066	LTN1_SCHPO E3 ubiquitin-protein ligase listerin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rkr1 PE=3 SV=1
7	Q385R6	2.03e-17	91.7	1706	0.030	0.031	Q385R6_TRYB2 E3 ubiquitin-protein ligase listerin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2670 PE=3 SV=1
8	Q12157	0.003	42.4	165	0.012	0.127	APC11_YEAST Anaphase-promoting complex subunit 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=APC11 PE=1 SV=1
9	Q9CAJ8	0.009	41.2	166	0.010	0.108	Q9CAJ8_ARATH At1g63840/T12P18_14 OS=Arabidopsis thaliana OX=3702 GN=At1g63840 PE=2 SV=1
10	Q9XF92	0.024	40.0	170	0.011	0.112	BRH1_ARATH Brassinosteroid-responsive RING protein 1 OS=Arabidopsis thaliana OX=3702 GN=BRH1 PE=2 SV=1
11	Q9SUS5	0.045	38.9	157	0.012	0.134	RHA1B_ARATH E3 ubiquitin-protein ligase RHA1B OS=Arabidopsis thaliana OX=3702 GN=RHA1B PE=2 SV=1
12	Q4Q2E8	0.067	40.8	2628	0.026	0.018	Q4Q2E8_LEIMA non-specific serine/threonine protein kinase OS=Leishmania major OX=5664 GN=TOR3 PE=3 SV=1
13	Q6NRV0	0.11	39.7	464	0.008	0.032	TRAIP_XENLA E3 ubiquitin-protein ligase TRAIP OS=Xenopus laevis OX=8355 GN=traip PE=1 SV=2
14	Q9LZJ6	0.12	38.9	257	0.011	0.078	ATL5_ARATH RING-H2 finger protein ATL5 OS=Arabidopsis thaliana OX=3702 GN=ATL5 PE=2 SV=1
15	Q9LUL6	0.16	38.1	204	0.010	0.088	ATL61_ARATH Putative RING-H2 finger protein ATL61 OS=Arabidopsis thaliana OX=3702 GN=ATL61 PE=3 SV=1
16	Q8L9T5	0.22	38.1	304	0.011	0.062	ATL2_ARATH RING-H2 finger protein ATL2 OS=Arabidopsis thaliana OX=3702 GN=ATL2 PE=2 SV=2
17	Q9LUZ9	0.23	38.1	308	0.010	0.055	ATL63_ARATH RING-H2 finger protein ATL63 OS=Arabidopsis thaliana OX=3702 GN=ATL63 PE=2 SV=1
18	Q9LY41	0.25	38.1	334	0.014	0.072	ATL4_ARATH E3 ubiquitin-protein ligase ATL4 OS=Arabidopsis thaliana OX=3702 GN=ATL4 PE=1 SV=1
19	Q3MUH5	0.28	38.1	373	0.012	0.056	Q3MUH5_CHICK Fanconi anemia protein FANCL OS=Gallus gallus OX=9031 GN=FANCL PE=1 SV=1
20	Q9XI67	0.28	37.0	179	0.007	0.073	Q9XI67_ARATH At1g14200 OS=Arabidopsis thaliana OX=3702 GN=At1g14200 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11793 FANCL_C	0.2	23.2	FANCL C-terminal domain
2	PF18253 HipN	1.8e+02	13.2	Hsp70-interacting protein N N-terminal domain
3	PF12906 RINGv	35	15.9	RING-variant domain
4	PF12861 zf-ANAPC11	0.26	22.7	Anaphase-promoting complex subunit 11 RING-H2 finger
5	PF00097 zf-C3HC4	48	15.2	Zinc finger, C3HC4 type (RING finger)
6	PF12678 zf-rbx1	2.2	20.0	RING-H2 zinc finger domain
7	PF16744 zf-RING_15	9e+02	11.4	KIAA1045 RING finger
8	PF13639 zf-RING_2	0.0042	28.7	Ring finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000478783

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000298310	0.999	Nuclear export mediator factor NEMF
2	9606.ENSP00000351777	0.964	Transitional endoplasmic reticulum ATPase
3	9606.ENSP00000263346	0.937	Transcription factor 25
4	9606.ENSP00000346001	0.889	60S ribosomal protein L3
5	9606.ENSP00000445508	0.879	CCR4-NOT transcription complex subunit 4
6	9606.ENSP00000356811	0.877	HBS1-like protein
7	9606.ENSP00000290650	0.871	E3 ubiquitin-protein ligase UBR1
8	9606.ENSP00000411409	0.867	E3 ubiquitin-protein ligase ZNF598
9	9606.ENSP00000386717	0.853	Ribosomal protein L31
10	9606.ENSP00000389103	0.847	60S ribosomal protein L23a
11	9606.ENSP00000463784	0.839	Component of the large ribosomal subunit.
12	9606.ENSP00000359345	0.838	60S ribosomal protein L5
13	9606.ENSP00000400467	0.837	L ribosomal proteins
14	9606.ENSP00000225430	0.835	Ribosomal protein L19
15	9606.ENSP00000375730	0.830	60S ribosomal protein L13a
16	9606.ENSP00000262584	0.827	60S ribosomal protein L8
17	9606.ENSP00000346015	0.826	Ribosomal protein L27a
18	9606.ENSP00000259469	0.824	60S ribosomal protein L35
19	9606.ENSP00000387361	0.824	Strawberry notch homolog 1
20	9606.ENSP00000309830	0.823	Ribosomal protein L38

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0061630	1.000	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0006807	0.997	nitrogen compound metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0043170	0.995	macromolecule metabolic process
GO:0044260	0.992	cellular macromolecule metabolic process
GO:0019538	0.992	protein metabolic process
GO:0009057	0.978	macromolecule catabolic process
GO:0006511	0.969	ubiquitin-dependent protein catabolic process
GO:0010498	0.915	proteasomal protein catabolic process
GO:0043161	0.813	proteasome-mediated ubiquitin-dependent protein catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005829	0.999	cytosol
GO:0043231	0.876	intracellular membrane-bounded organelle
GO:1990112	0.716	RQC complex
GO:0070013	0.698	intracellular organelle lumen
GO:0043232	0.559	intracellular non-membrane-bounded organelle
GO:0005634	0.557	nucleus
GO:0016020	0.509	membrane
GO:0031981	0.307	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]